(data stored in SCRATCH zone)

EMBL: CP001778.PE67

CP001778.PE67        Location/Qualifiers
FT   CDS_pept        76446..76973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39790"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0C6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39790.1"
FT                   /translation="MDLTLERLNVMATSPDKSVQARMSNAAGLQVKLEPGTVDRHTERS
FT                   LGTQLTAAVNGAITGYRKGAAKAFGVLRAQWGMPSRSDADPELQDEPQTVTTSGAGNVS
FT                   VRMRGETVTAVGLHPGTLRRISEPELLDELRDALLSAMTRHAELITAKSRTTATATPRP
FT                   LERTASWRTTSK"
     atggatctga cattggagcg gctgaacgtc atggcgacgt ctcccgacaa atccgtccag        60
     gcgcggatgt cgaacgccgc gggtcttcag gtcaagctgg agcccggcac cgtcgacagg       120
     cacaccgaac gttcgctggg cacccagctc accgccgccg tcaacggagc gatcaccggt       180
     taccggaagg gagcggccaa ggcgttcggc gtgttgcgcg cgcagtgggg catgccgagc       240
     cggtcggacg ccgaccccga actccaggac gaaccccaga ccgtgacgac atccggcgcc       300
     gggaacgtct cggtgcgcat gcgcggggag accgtgaccg cggtcggcct gcaccccggc       360
     acgctgcggc ggatctccga acccgagctc ctcgacgagt tgcgggacgc gttgttgtcc       420
     gccatgaccc gtcacgccga gctgatcacg gccaagtccc gaaccaccgc aacagcgacc       480
     ccccgtccac tggaaaggac agcctcatgg cggacgacat cgaagtag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page