(data stored in ACNUC7421 zone)

EMBL: CP001791.PE1

CP001791.PE1         Location/Qualifiers
FT   CDS_pept        654..2009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   gur:Gura_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97553"
FT                   /db_xref="GOA:D6XUZ5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADH97553.1"
FT                   /translation="MENLNDLWDQVLSKIEQKVSKPSFDTWFKYTVVDSIDQSSNTITV
FT                   IAPNEFARDWLENRYFSILTETLYELTGAELEARFILPKDEGSDLDFVEKNNPPVLQED
FT                   LDNGETTKHMLNTKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTH
FT                   LMHAIGHYVVDHNPDAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDILLIDDIQF
FT                   LAGKEQTQEEFFHTFNALHEERKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPD
FT                   LETRIAILRKKAKAENLDIPKEVMNYIANQIDTNIRELEGALIRVVAYSSLINQDMNAD
FT                   LAAVALKDIIPNSKPKKVTIESVQEAVAAHFQIRVEEMKAKKRTKTVAYPRQIAMYMAR
FT                   EMTDSSLPKIGNEFGKRDHTTVIHAHEKISRLFADDEELQQHIREITEKLRS"
     ttggagaatt taaatgattt atgggatcag gtcctgtcga aaatcgaaca gaaagtcagc        60
     aaaccgagtt ttgacacctg gttcaaatat acggtggtgg actccattga ccagagttca       120
     aacaccatca cggtcatcgc gcctaatgaa tttgcccgtg actggcttga gaaccgctat       180
     ttcagcattc tgactgaaac gctttatgaa ctcaccggcg cggaacttga agcacgcttt       240
     attttaccga aggatgaagg atcggatctc gattttgtcg aaaaaaacaa cccgcctgtt       300
     cttcaggagg atttggataa cggcgaaacg acgaagcata tgctcaatac aaagtataca       360
     ttcgatacgt tcgtcatcgg cagtggcaac cgtttcgccc acgcagcttc actggctgtt       420
     gccgaagcac cggcgaaagc ctataatccg ctgtttattt atggaggcgt cggtctcggc       480
     aagacccact tgatgcacgc catcggccac tatgtcgtcg atcataatcc cgatgcaaaa       540
     gtcgtctatc tgtcctctga gaaatttacg aacgagttta tcaactcgat ccgggataac       600
     aaagccgttg attttcggaa taaataccgc aatgtcgata ttcttctgat tgatgacatt       660
     cagtttctcg caggcaaaga acagacgcag gaggaattct tccacacgtt caacgccctg       720
     catgaagaac gaaagcagat catcatctca agtgaccggc ctccaaaaga gattccgact       780
     cttgaagacc ggcttcgatc ccgttttgaa tggggactga ttacagacat tacaccaccg       840
     gatctcgaga cgcgaattgc gattctccgt aaaaaagcaa aagcggaaaa tctcgatatt       900
     cctaaagaag tgatgaacta cattgccaat cagatcgata cgaacattcg cgaacttgaa       960
     ggggcgctga tccgggtcgt cgcttactca tccctgatca atcaggacat gaatgccgat      1020
     ctcgcagccg ttgccctgaa agatatcatt ccaaacagca aaccgaaaaa agtgaccatt      1080
     gaatccgtcc aggaagcagt ggcggcccat tttcaaatcc gcgttgagga aatgaaagcg      1140
     aaaaaacgca caaaaaccgt tgcttatcca agacagattg caatgtatat ggcacgggag      1200
     atgaccgaca gctcccttcc gaagatcggg aatgaatttg gcaaacggga tcacaccacc      1260
     gtgattcatg cccacgaaaa aatcagccgg ctttttgccg atgatgaaga acttcagcag      1320
     cacatccggg agatcacaga gaaactccgt tcatag                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page