(data stored in ACNUC7421 zone)

EMBL: CP001791.PE101

CP001791.PE101       Location/Qualifiers
FT   CDS_pept        124204..124569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0104"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="KEGG: vha:VIBHAR_00226 50S ribosomal protein L7/L12;
FT                   TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97653"
FT                   /db_xref="GOA:D6XVN0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN0"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADH97653.1"
FT                   /translation="MTHQDMIAAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAAGAGAG
FT                   EEAAAEQTEFDVVLESAGSSKIGVIKIVREITGLGLKDAKALVDGVPAPVKEGVEKAEA
FT                   EEIKGKLEEAGASVELK"
     atgactcatc aagacatgat cgctgcgatc aaagaaatgt ccgtacttga attgaatgac        60
     cttgtaaaag caatcgaaga agaatttggt gtaactgctg ctgctcctgt agctgctgca       120
     ggtgccggtg ccggtgaaga agccgctgct gagcagactg aattcgacgt agttcttgaa       180
     agtgccggat cttccaagat cggcgttatt aagatcgttc gtgaaatcac tggtcttggt       240
     cttaaagacg caaaagcact cgttgacggt gttcctgcac cagtcaaaga aggcgttgaa       300
     aaagcagaag ctgaagaaat caaaggcaag cttgaagaag caggcgcttc tgttgaactc       360
     aagtaa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page