(data stored in ACNUC7421 zone)

EMBL: CP001791.PE102

CP001791.PE102       Location/Qualifiers
FT   CDS_pept        124700..125305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0105"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; putative RNA
FT                   methylase; KEGG: tgr:Tgr7_2883 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97654"
FT                   /db_xref="GOA:D6XVN1"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN1"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADH97654.1"
FT                   /translation="MSDHYYTNKPGVKSSRRSFTDELRGQRLTFTVDKGVFSGGGVDFG
FT                   SRLLIESFTEPETEGDLLDIGCGWGPIGIALAMSTDQRRINMIDVNERSVELARLNAEA
FT                   NGVADNVHIEQRDATEGLPGDGCAAILTNPPIRAGKDVVFAIYEEASRQLKHGGELWVV
FT                   IQKKQGAPSTEEKLKALGLDVRTVTKKKGYVIFAGKKD"
     atgagtgacc attactatac gaataaaccc ggtgtcaaaa gcagtcggcg ctcgttcacg        60
     gatgagctcc gcggccaacg cctgacgttt actgttgata aaggcgtctt ctcagggggc       120
     ggcgtcgatt ttggttcgag gctgctgatt gagagtttta ccgaacctga gacagaaggt       180
     gacctgctgg acatcggctg tggctggggt cctatcggca tcgcccttgc gatgagtacc       240
     gatcagaggc ggatcaacat gatcgatgtc aatgaacgct ccgtcgaact cgcgcggctt       300
     aacgccgagg cgaacggcgt cgccgacaac gtgcatatcg aacagcgtga tgcaacggaa       360
     gggcttccgg gtgacggctg tgcggcgatc cttaccaatc cgccgatccg cgcaggcaaa       420
     gatgttgtct ttgcgattta tgaagaggcg agtcggcagc tgaagcacgg aggcgagctt       480
     tgggtcgtca tccagaagaa gcagggcgcg ccgtcgacgg aagaaaaact gaaagcgctc       540
     ggactggatg tgcgtaccgt tacgaagaaa aaaggctacg tcatcttcgc cggaaaaaaa       600
     gattga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page