(data stored in ACNUC7421 zone)

EMBL: CP001791.PE106

CP001791.PE106       Location/Qualifiers
FT   CDS_pept        133451..133864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0109"
FT                   /product="ribosomal protein S12"
FT                   /note="KEGG: gem:GM21_3333 ribosomal protein S12; TIGRFAM:
FT                   ribosomal protein S12; PFAM: ribosomal protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97658"
FT                   /db_xref="GOA:D6XVN5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN5"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADH97658.1"
FT                   /translation="MPTINQLVRKGRKSKVKSPDSPALNKGYNSFKKHQTDEDSPQKRG
FT                   VCTRVGTMTPKKPNSALRKYARVRLTNQIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGSLDTAGVEGRMQSRSKYGTKRPKK"
     atgcctacta ttaatcagct tgtacgaaaa ggccgtaagt caaaggtgaa atcacctgac        60
     tccccagctt tgaacaaagg ctacaacagc ttcaagaaac accagacaga tgaggattct       120
     cctcaaaagc gcggtgtttg tacgcgtgtc ggtacaatga caccgaagaa gccgaactca       180
     gcccttcgta agtatgctcg tgttcgcttg acgaaccaga ttgaggtaac tgcttatatc       240
     ccgggtatcg gacacaacct gcaagagcac agtgttgtcc tgatccgcgg tggtcgtgta       300
     aaagacttac cgggggtacg ttatcacatc gttcgcggaa gcttggacac tgccggtgtt       360
     gaaggccgta tgcagagccg ttcaaaatac ggaacaaagc gtcctaagaa ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page