(data stored in ACNUC7421 zone)

EMBL: CP001791.PE107

CP001791.PE107       Location/Qualifiers
FT   CDS_pept        133925..134395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0110"
FT                   /product="ribosomal protein S7"
FT                   /note="KEGG: dvu:DVU1299 30S ribosomal protein S7; TIGRFAM:
FT                   ribosomal protein S7; PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97659"
FT                   /db_xref="GOA:D6XVN6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN6"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADH97659.1"
FT                   /translation="MPRKGPVARRDVLADPIYNSKLVTRLINRIMVHGKRGKAQTILYN
FT                   AFDLVRERTGNDPQEVFEQALKNIMPVLEVKARRVGGANYQVPIEVKPDRRTTLGLRWL
FT                   VSYARLRGEKTMEERLANEIMDAANNTGAAVKKREDTHKMAEANKAFAHYRW"
     atgccacgta aaggacctgt agcacgcaga gacgtgctcg ctgacccgat ttacaactcg        60
     aaactggtaa cccgcttaat caaccgcatc atggtgcatg gtaagcgcgg taaagcccag       120
     acgattcttt ataatgcatt tgatctcgtt cgtgaacgta ccgggaatga tcctcaggaa       180
     gttttcgaac aggcactcaa gaacattatg ccggtactgg aggtaaaagc acgccgtgta       240
     ggtggtgcaa actaccaggt accgatcgaa gtaaagccgg accgccgtac aactctcggt       300
     ttgagatggc tcgtaagcta tgcacgtctc cgcggtgaga agaccatgga agagcgtctt       360
     gctaacgaaa tcatggatgc agccaacaac acgggtgcag ccgttaagaa acgcgaagat       420
     acacacaaaa tggcggaagc aaacaaagcg tttgcccact accgctggta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page