(data stored in ACNUC7421 zone)

EMBL: CP001791.PE108

CP001791.PE108       Location/Qualifiers
FT   CDS_pept        134494..136572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0111"
FT                   /product="translation elongation factor G"
FT                   /note="KEGG: gsu:GSU2860 elongation factor G; TIGRFAM:
FT                   translation elongation factor G; small GTP-binding protein;
FT                   PFAM: protein synthesis factor GTP-binding; elongation
FT                   factor G domain protein; elongation factor Tu domain 2
FT                   protein; elongation factor G domain IV"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97660"
FT                   /db_xref="GOA:D6XVN7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVN7"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADH97660.1"
FT                   /translation="MAREFSLEKTRNIGIMAHIDAGKTTATERILFYSGRIHKIGETHD
FT                   GGSQMDWMEQEQERGITITSAATTAQWNEHRINIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKLGADFIYSLGTLEDRLGANAAAVQ
FT                   LPIGAEDDFEGIIDLINMQAYFYLDDLGTRSEAREIPDEYKDQAEEYRDKLMEKVSEFD
FT                   EDFMMKYLEGEEITTDELKRAIRAATVSVEFYPVFCGSAFKNKGVQLLLDGVIDYLPAP
FT                   TDVAAITGIDLDTEEEVVRKPGDNEPFSALAFKVATDPFVGKLTFFRVYSGMVNAGSYV
FT                   KNSTKGKRERMGRILQMHANHREEIPTCFSGDIAAGVGLKDTGTGDTLCGEKENIILES
FT                   MEFPDPVISLSVEPKSKADQDKMGMALAKLAEEDPTFKTHTDDETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVDANVGAPQVSYRETLRQAANCEGKFVRQSGGRGQYGHVWIEFMPNDE
FT                   GAGFEFVDNIVGGVVPREYIGSVEAGVKDALDNGLLAGYPLVDVKARLYDGSYHDVDSN
FT                   EMAFKVAASMALKEAKKKCNPVLLEPIMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQIVKAMVPLSEMFGYATSLRSNTQGRGNYSMHFDHYEEVPKSISEEIIKKQGGE"
     atggcaagag agttctcctt agaaaagact cgtaatatcg ggattatggc tcacatcgat        60
     gctggtaaga cgacagcaac ggagcgtatt cttttctatt caggccgtat ccataagatc       120
     ggtgaaactc acgacggcgg ttcacaaatg gactggatgg agcaggagca ggagcgtgga       180
     atcacgatta cctctgctgc aacaacagct cagtggaacg aacaccgtat taacattatc       240
     gacacaccag ggcacgtaga cttcacagtc gaagttgaac gttcgctccg tgtactcgat       300
     ggtgctgtag ctgtacttga tgcccagtcc ggtgttgagc cacagacaga aaccgtttgg       360
     cgtcaggcga cgacttacgg cgtgccgcgt atcgtgttcg tcaacaagat ggacaagctc       420
     ggtgcagact tcatctattc actcggtacc cttgaggacc gacttggtgc gaacgctgcg       480
     gctgttcaac tgccaatcgg tgctgaagat gacttcgaag ggattattga cctgatcaac       540
     atgcaggcat acttctacct cgatgatctc ggaacacgca gtgaagcacg tgaaattcct       600
     gatgagtaca aggatcaggc tgaagaatac cgtgacaagc tcatggaaaa agtatccgaa       660
     ttcgatgaag acttcatgat gaagtatctc gaaggggaag aaatcacaac ggatgaacta       720
     aagcgcgcga tccgtgctgc gacagtcagc gttgaattct acccggtctt ctgcggttcc       780
     gcgttcaaga acaaaggggt tcagctcctg cttgacggcg tgatcgacta cctgccggca       840
     ccaactgacg ttgcggctat cacaggtatt gacctcgata ctgaagaaga agttgtccgt       900
     aagccaggcg ataacgagcc gttctccgcc cttgcattta aggtcgcaac ggatccgttc       960
     gtcggtaaac tgacattctt ccgtgtctat tccggtatgg ttaatgcggg ttcttatgtt      1020
     aagaactcaa ccaaaggtaa gcgtgagcgc atgggtcgta tcctgcagat gcacgcaaac      1080
     caccgtgaag aaatcccaac atgtttctcc ggcgatatcg ctgcgggtgt tggtttgaaa      1140
     gatacaggaa caggtgatac gctctgtgga gagaaagaga atatcattct tgaatccatg      1200
     gaattccctg atccggttat ctccctgtct gttgagccta aatcaaaagc agaccaggac      1260
     aaaatgggta tggcacttgc caaactcgct gaagaagatc cgacgttcaa gacgcacaca      1320
     gatgatgaaa caggccagac gatcatcgca ggtatgggtg agcttcacct tgacatcatc      1380
     gttgaccgta tgcgccgtga attcaaagtg gacgccaatg tcggtgctcc tcaggtatcg      1440
     tatcgtgaaa cacttcgtca agcagcaaac tgtgaaggga aattcgttcg tcagtccggt      1500
     ggacgcggtc agtacggtca cgtatggatc gagtttatgc cgaatgacga aggtgcaggc      1560
     tttgaattcg tagacaacat cgttggtggt gttgttccgc gtgaatacat cggttccgtt      1620
     gaagccggtg tcaaagacgc actcgataac ggacttctcg ccggttaccc gcttgttgac      1680
     gtgaaagcgc gtctttatga cggttcttac cacgatgtcg attccaacga aatggccttt      1740
     aaggttgcag cttccatggc gcttaaagaa gcgaagaaga agtgtaaccc ggttctcctt      1800
     gagccgatca tgaaggtcga agttgttatc cctgaagagt atatgggtga catcatgggt      1860
     gacgtaacgt cacgccgtgg acgtgtggaa ggtatggaag cccgcggtaa cgctcaaatc      1920
     gtaaaagcga tggtcccact ttccgagatg ttcggttacg caacgtccct gcgttcaaac      1980
     acacagggtc gcggtaacta ctccatgcac ttcgaccact atgaagaagt gccaaagagc      2040
     atcagtgaag aaatcattaa gaagcagggc ggcgagtaa                             2079
//

If you have problems or comments...

PBIL Back to PBIL home page