(data stored in ACNUC7421 zone)

EMBL: CP001791.PE11

CP001791.PE11        Location/Qualifiers
FT   CDS_pept        19638..21035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0012"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: csa:Csal_1549 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97563"
FT                   /db_xref="GOA:D6XV05"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV05"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ADH97563.1"
FT                   /translation="MLKKWGYALAAVTVSAAVLVPTERAEASYEPTVDTVILVDAKSGR
FT                   VLFERNIDQPLPPASMTKMMSEYLILEAVNDGDISWDTNVPISDFLASLSHNRSLSNVP
FT                   LRVDGEYNVEELYESVAIYSANASTMALAELISGSEGAFVSEMNEKGVELGLGTLMREA
FT                   GGEYGLEDLGEISEEGLGSFQFVNSTGLPNRLLEGNHPEGTGAEEDNYMSARAAATLAY
FT                   YLVNDYPEVLDVAGIPHKVFREGTGDAIDMPNWNNMIPGTENSHLDYEYVDGLKTGHTN
FT                   AAGFTFTGTGEKDGQRLVSVVMGADSIEHRFQETQRVLEWGFNTFYEEEIYAAGYSPDG
FT                   FETIAVSKGEEEEVPLESTEAIHRLIQEGDEELYSYEVVLDEDLLDEDGAMEAPVEAGT
FT                   VVGQMIISFDGEEDYIHDEIDRTTVVDLITTSDVERSGWFTLMLESIGGFFTGLWHSVT
FT                   ETVRGWL"
     atgctaaaaa aatggggata tgcattagcc gcagttacag taagtgcagc agttcttgtc        60
     ccgacggagc gggctgaagc aagttatgaa ccgacggtag ataccgtgat tctggtagat       120
     gcgaaatcag gacgagtgct gtttgaacgg aatattgatc agcctttgcc acctgcaagt       180
     atgacaaaaa tgatgagtga gtatctgatt cttgaagctg tcaatgacgg tgacatcagc       240
     tgggatacaa atgttcctat cagtgacttt ctcgcctcgc tttcccataa ccgatcactc       300
     tccaatgtcc cgttaagggt ggatggtgaa tacaatgtgg aagaactgta tgaatcagtg       360
     gccatttatt cggccaatgc gtcaacgatg gcacttgctg aactgatctc agggtctgaa       420
     ggcgcgttcg tcagtgagat gaatgaaaaa ggcgttgagc tcggtttagg cacactgatg       480
     cgtgaagctg gcggcgaata cggactcgag gatctcgggg agatttcaga agaaggtctc       540
     ggttcgtttc agtttgtgaa ttccacaggt cttccaaacc gattgcttga agggaatcac       600
     ccggaaggaa caggagcgga agaggataac tacatgtctg ccagagcggc cgcaaccctg       660
     gcatattacc tcgtcaatga ttatcccgag gtcctggatg tagcgggcat tcctcataaa       720
     gtgttccgtg aaggaaccgg cgatgccatt gatatgccaa actggaacaa catgatcccg       780
     ggaacggaaa acagccacct tgactacgaa tacgtcgacg ggctgaagac aggtcatacc       840
     aacgcagcgg gatttacttt tacaggtacg ggtgaaaaag acggacagcg tcttgtcagt       900
     gtcgtcatgg gggcagactc cattgaacac cgtttccaag agacgcagcg cgtcctggag       960
     tggggtttta atacattcta tgaagaagaa atctacgcag ccggttacag ccctgatggc      1020
     tttgaaacca ttgctgtttc caaaggggaa gaagaagaag tgccgttgga atcgacagag      1080
     gccatacacc gtctgattca ggaaggcgac gaggaactct acagctatga agtggttctt      1140
     gatgaggatc tccttgacga agacggtgca atggaagcac ctgtcgaagc cggaacggtt      1200
     gtcggtcaga tgatcatttc ctttgacggg gaggaagatt atattcatga cgaaatcgac      1260
     cggacgaccg tcgttgatct gattacaacg tcggatgtgg agcgctcagg ctggtttacg      1320
     ctgatgcttg agagtattgg cggcttcttt acaggactat ggcattctgt tacagaaacg      1380
     gtgcgcggtt ggctgtaa                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page