(data stored in ACNUC7421 zone)

EMBL: CP001791.PE112

CP001791.PE112       Location/Qualifiers
FT   CDS_pept        139469..140095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0115"
FT                   /product="50S ribosomal protein L3"
FT                   /note="KEGG: glo:Glov_1346 50S ribosomal protein L3;
FT                   TIGRFAM: 50S ribosomal protein L3; PFAM: ribosomal protein
FT                   L3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97664"
FT                   /db_xref="GOA:D6XVP1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP1"
FT                   /inference="protein motif:TFAM:TIGR03625"
FT                   /protein_id="ADH97664.1"
FT                   /translation="MTKGILGKKLGMTQIFSENGEQVPVTVIEASPNVVLQKKTAEGEG
FT                   YEAIQIGYDDKKANRQNSPEKGHAEKAKTAPKRFVKEIRDVNTADYEIGQEIKVDIFAE
FT                   GDAIDVTGTSKGKGFQGAIKRHNQSRGPMSHGSRYHRRPGSMGPVDPNHVRPGKLLPGQ
FT                   MGGETVTIQNLEVVKVDTERNVILVKGNVPGARKSFVTITSATKA"
     atgaccaaag gaatcttagg aaagaaatta ggtatgaccc agattttctc tgagaatggt        60
     gagcaggtac cggtaacggt aatcgaagct tccccaaacg ttgttcttca gaagaagaca       120
     gctgaaggcg aaggctacga agcgatccag atcggctatg acgacaagaa agccaaccgt       180
     cagaacagcc cggagaaagg tcatgcagaa aaagcgaaga ccgctcctaa gcgcttcgta       240
     aaggaaatcc gtgatgtgaa cacagcggat tatgaaattg gtcaggagat caaggtagat       300
     atttttgcgg agggagacgc cattgacgtc accggaacat cgaagggtaa aggtttccag       360
     ggtgccatta agcgccacaa ccagtcccgc ggaccgatgt cccacggttc ccgttatcac       420
     cgtcgtccag gttccatggg tcctgttgac ccgaaccacg tacgaccagg taagctcctt       480
     ccaggacaaa tgggcggaga aactgtaacc attcaaaacc ttgaagttgt caaagtggat       540
     actgaacgaa acgtaattct cgttaaaggt aatgtaccgg gtgcgagaaa gagcttcgtc       600
     acgatcactt cagcaacgaa agcataa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page