(data stored in ACNUC7421 zone)

EMBL: CP001791.PE114

CP001791.PE114       Location/Qualifiers
FT   CDS_pept        140746..141036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0117"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: sfu:Sfum_1557
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97666"
FT                   /db_xref="GOA:D6XVP3"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP3"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADH97666.1"
FT                   /translation="MATARDIIKRPIITERSADLMVDKKYTFEVNPRANKVQIRNAVEE
FT                   IFGVTVTNVNTMNYKGKFKRFGRYSGYTRKRKKAIVELSADSKELEFFEGV"
     atggcaacag cccgtgacat cattaagcgc ccgattatca ccgaacgatc tgcggatctg        60
     atggtggaca agaagtacac attcgaagtg aacccgcgtg ccaacaaggt acaaatccgc       120
     aatgcggttg aggaaatctt cggcgtgact gtaaccaatg tcaacacaat gaactacaaa       180
     ggaaaattca agcgtttcgg ccgttactca ggctatacac gcaagcgcaa aaaagccatt       240
     gttgaattat ccgctgacag caaagaactc gagttctttg aaggcgtata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page