(data stored in ACNUC7421 zone)

EMBL: CP001791.PE116

CP001791.PE116       Location/Qualifiers
FT   CDS_pept        141958..142236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0119"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: mmw:Mmwyl1_4272 ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97668"
FT                   /db_xref="GOA:D6XVP5"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP5"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADH97668.1"
FT                   /translation="MGRSLKKGPFVDEHLMKKVEAQSENNDKKVIKTWSRRSTIFPQFI
FT                   GHTIAVYDGRKHVPVYVQEDMVGHKLGEFAPTRTYKGHASDDRKTKR"
     atgggtcgta gcttgaaaaa aggacctttt gtcgatgagc atctcatgaa aaaggtggaa        60
     gctcagagtg agaacaatga taagaaagtg atcaagacct ggtcacgccg ttcaacgatt       120
     ttcccacaat tcatcggaca cacaatcgcc gtttatgacg gacgaaagca cgtgccggtt       180
     tacgttcagg aagatatggt tggtcacaag ctcggagaat ttgcgcctac ccgaacatac       240
     aaaggccatg catccgacga tagaaaaact aaacgctaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page