(data stored in ACNUC7421 zone)

EMBL: CP001791.PE117

CP001791.PE117       Location/Qualifiers
FT   CDS_pept        142259..142600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0120"
FT                   /product="ribosomal protein L22"
FT                   /note="KEGG: pca:Pcar_0706 50S ribosomal protein L22;
FT                   TIGRFAM: ribosomal protein L22; PFAM: ribosomal protein
FT                   L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97669"
FT                   /db_xref="GOA:D6XVP6"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVP6"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADH97669.1"
FT                   /translation="MEAKAVAKQVRIAPRKVRLVIDLIRGKEVGEAISILNHTPKKASP
FT                   VVEKLLNSAIANAEHNYEMEPDNLVVSQAFVDEGVTLKRFRPRAQGRASRINKRTSHIT
FT                   LVLTEKKEG"
     atggaagcaa aagcagttgc aaaacaagtg cgtattgctc ctcgaaaagt tcgcctggtc        60
     attgatttga tccgtggcaa agaggttggt gaagccatct ccatcctgaa ccacacaccg       120
     aagaaagcat ctccggttgt cgagaagctt ctgaattccg ccattgcgaa cgcagagcac       180
     aattatgaaa tggaacctga caatctcgtt gtcagtcaag catttgtaga tgaaggtgtt       240
     acactcaagc gtttccgtcc acgtgcacag ggacgtgcga gccgaatcaa caaacgtacg       300
     agccatatta cgctcgttct tacagaaaag aaggagggat aa                          342
//

If you have problems or comments...

PBIL Back to PBIL home page