(data stored in ACNUC7421 zone)

EMBL: CP001791.PE123

CP001791.PE123       Location/Qualifiers
FT   CDS_pept        144623..144949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0126"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: rfe:RF_0289 50S ribosomal protein L24;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97675"
FT                   /db_xref="GOA:D6XVQ2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ2"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADH97675.1"
FT                   /translation="MKQPTLHVKKGDNVKVISGKDKGKEGKILEAYPSQSRVLVEGVNM
FT                   VKKHAKPSQANPQGGILTQEAAIHVSNVMPIDPKTGEPTRVGYKEENGKKVRIAKKSGE
FT                   SLDN"
     atgaaacaac cgacattgca tgtcaaaaaa ggagacaacg ttaaagtcat ctccggtaaa        60
     gacaaaggca aagaaggtaa aatccttgaa gcatatccaa gccagtcccg tgtactggtt       120
     gaaggagtca atatggttaa gaagcatgcc aaaccgtccc aggcgaatcc gcaaggcgga       180
     atcctgacgc aggaagctgc tattcacgtc tcaaacgtga tgcctatcga cccgaaaaca       240
     ggtgaaccga cccgagttgg atacaaggaa gagaatggta agaaagtaag aatcgcaaag       300
     aaatccggcg aatccctcga taactga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page