(data stored in ACNUC7421 zone)

EMBL: CP001791.PE126

CP001791.PE126       Location/Qualifiers
FT   CDS_pept        145766..146164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0129"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: ppd:Ppro_0694 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97678"
FT                   /db_xref="GOA:D6XVQ5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ5"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADH97678.1"
FT                   /translation="MVMTDPIADMLTRIRNANTVRHNSLELPSSKMKIQIADILKREGF
FT                   IRDYENIEDNKQGILRIFLKYGADNQKVITGLKKISKPGLRVYAKSDELPRVLGGLGIA
FT                   VISTSDGIVTDKEARQKKAGGEVIAYVW"
     atggtcatga cagatccgat tgctgacatg ctgactcgca tccgaaatgc gaacacagtc        60
     agacacaata gcttagagct tccaagctca aaaatgaaaa tccagatcgc agacatcctg       120
     aagcgtgaag gcttcatccg cgattatgaa aatatcgaag ataacaagca gggcattctt       180
     cgtattttcc ttaagtacgg agcagataat caaaaagtta tcaccggact taagaaaatc       240
     agtaagccag gactccgcgt ttacgcgaaa tccgatgaac tgccacgagt actcggcgga       300
     ttgggaattg cagttatctc aacatccgac ggtatcgtaa cagataaaga agcccgtcag       360
     aagaaagccg gcggcgaagt tatcgcatac gtttggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page