(data stored in ACNUC7421 zone)

EMBL: CP001791.PE128

CP001791.PE128       Location/Qualifiers
FT   CDS_pept        146765..147127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0131"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: dat:HRM2_36100 RplR; TIGRFAM: ribosomal
FT                   protein L18; PFAM: ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97680"
FT                   /db_xref="GOA:D6XVQ7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ7"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADH97680.1"
FT                   /translation="MITKTDKNAVRKKRHAHVRRSITGTAERPRLNVFRSNNHIYAQLI
FT                   DDVAGVTLASASTVDKELNIEKGGNKEAARKVGELVAKRALDKGYESIVFDRGGYLYHG
FT                   RVKELADGAREAGLKF"
     atgatcacga agactgacaa gaacgcggta cgtaaaaagc gtcacgcgca cgttcgtcgc        60
     tcgatcaccg gcactgctga acgtcctcgt ctcaatgttt tccgttccaa taaccatatt       120
     tatgcacagc tgatcgacga tgttgcaggg gttaccctcg caagcgcgtc cactgtggat       180
     aaagagttaa acattgaaaa aggcgggaac aaagaagcag cccgtaaagt gggcgaactc       240
     gttgcaaaac gcgccctgga taagggttac gaatccatcg tatttgaccg tgggggctac       300
     ctttatcacg gtcgtgtaaa agaacttgca gacggcgctc gcgaagccgg actcaagttt       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page