(data stored in ACNUC7421 zone)

EMBL: CP001791.PE129

CP001791.PE129       Location/Qualifiers
FT   CDS_pept        147153..147650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0132"
FT                   /product="ribosomal protein S5"
FT                   /note="KEGG: pca:Pcar_0718 30S ribosomal protein S5;
FT                   TIGRFAM: ribosomal protein S5; PFAM: Ribosomal protein S5;
FT                   ribosomal protein S5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97681"
FT                   /db_xref="GOA:D6XVQ8"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVQ8"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADH97681.1"
FT                   /translation="MRIDPTKLEIEERVVTVNRVAKVVKGGRRFRFAALVVVGDKNGHV
FT                   GFGMGKALEVPEAIRKAIEDGKKNMIQVPIQGTTIPHQITGKFGAGSVLLKPASEGTGV
FT                   IAGGPVRAVLELAGIGDILSKSLGSNNPINMVRATIQGLDEMKSPEEVAKLRGKSVEEL
FT                   LG"
     ttgcgtattg atccaactaa attggaaatt gaagaaagag ttgtaacggt caatcgagtt        60
     gcgaaagttg ttaaaggtgg acgtcgtttc cgctttgccg cactcgttgt cgttggagat       120
     aagaacgggc acgtcggatt tggaatgggt aaggcacttg aagtacctga agcgatccgt       180
     aaggcgatcg aagacggtaa gaaaaacatg attcaggtac cgattcaggg aacaacgatt       240
     cctcaccaga tcactgggaa gttcggagca ggcagcgtac tgctgaagcc ggcttctgaa       300
     ggtaccgggg taatcgcagg cggacctgtc cgtgcggtgc ttgaacttgc aggtattggt       360
     gacattcttt ccaagtccct gggttcaaac aacccaatta acatggtacg tgcgaccatc       420
     cagggtcttg acgaaatgaa gagccctgaa gaagttgcaa aactacgagg caaatctgtc       480
     gaagaattgc tgggttaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page