(data stored in ACNUC7421 zone)

EMBL: CP001791.PE134

CP001791.PE134       Location/Qualifiers
FT   CDS_pept        150137..150439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97686"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97686.1"
FT                   /translation="MKDPESDVQVGELVRILNGRDKDQFACVIEVLDERFVLIADGDKR
FT                   KVDRAKRKNISHIEPMKIVVPEVRNSIDDTGRVTNAKLRFAISSYLEDHLLKKGE"
     atgaaagatc ctgagtcgga cgtgcaggtc ggtgaacttg tgcgtatact gaatggacgg        60
     gataaagatc agtttgcgtg tgtgattgag gtgcttgatg aacgttttgt gctgatcgcg       120
     gacggcgata agcggaaagt ggaccgggca aagcggaaga acatctctca cattgaacca       180
     atgaagattg ttgttcctga agtgagaaat agcattgatg acaccgggcg tgtaacaaac       240
     gccaagctgc gtttcgccat ctcaagctat cttgaggatc atttactgaa gaagggagag       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page