(data stored in ACNUC7421 zone)

EMBL: CP001791.PE136

CP001791.PE136       Location/Qualifiers
FT   CDS_pept        150712..150825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0139"
FT                   /product="ribosomal protein L36"
FT                   /note="KEGG: pca:Pcar_0724 ribosomal protein L36; TIGRFAM:
FT                   ribosomal protein L36; PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97688"
FT                   /db_xref="GOA:D6XVR5"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVR5"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADH97688.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRKGTVMVICENPKHKQKQG"
     atgaaggtaa gaccatcagt gaaaccaatt tgtgagaaat gcaaggtcat tcgccgaaaa        60
     ggaaccgtca tggttatttg cgaaaatccg aaacacaaac aaaagcaagg ttaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page