(data stored in ACNUC7421 zone)

EMBL: CP001791.PE14

CP001791.PE14        Location/Qualifiers
FT   CDS_pept        22972..24246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0015"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: gme:Gmet_3528
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97566"
FT                   /db_xref="GOA:D6XV08"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV08"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADH97566.1"
FT                   /translation="MLDMKRLRADFEGVREKLATRNEDISALDDFQKLDEERRQVIQKV
FT                   EELKGKRNTVSEEISKMKRNKEDASDVIAEMKDVSAEIKALDEKQRDVDEKMKTLMLSI
FT                   PNIPHESAPVGLDETENEEIRTWGERPAFDFEGKAHWDLAVTHDIVDFERASKITGSRF
FT                   AIYKGAGARLERALMNFMMDFHEDKHGYTEVLPPYMVNRDSMTGTGQLPKFEEDAFQIR
FT                   EEDYFLIPTAEVPVTNMHRDEILTADELPIAYSAFSACFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVRFVKPEDSYAELEKLTGHAEKILQQLNLPYRVLNMCTGDLGFTAAKKYDIEVW
FT                   LPSYGEYKEISSCSNFEDFQARRANIRFKRDQKGKAEFVHTLNGSGLAIGRTVAAILEN
FT                   YQQADGTIKIPKVLQPYMGGKTRIG"
     atgctggaca tgaaacgatt gagagctgat tttgagggcg ttcgtgaaaa acttgcgacc        60
     cgcaatgaag acatcagcgc gttggatgat tttcagaagc ttgatgaaga acggcgtcag       120
     gtcattcaga aagtcgaaga gttaaaaggg aagcgcaata cggtttctga ggaaatttcg       180
     aaaatgaagc gaaacaaaga agatgcctcc gacgtcattg ccgagatgaa ggatgtctcc       240
     gcagagatta aagcacttga tgaaaagcag cgggacgtgg atgagaagat gaagacgctc       300
     atgctgtcga tcccgaatat tccccatgag agcgcgccgg ttggtctcga tgagacagag       360
     aacgaagaaa tccgcacgtg gggagagcgc ccggcgtttg atttcgaagg gaaggcgcat       420
     tgggatctcg cggtcactca tgacattgtg gactttgagc gtgcgtcaaa aatcacggga       480
     agccgttttg ccatttacaa aggtgccgga gcgaggctcg aacgggctct tatgaacttt       540
     atgatggact ttcatgaaga caagcacggc tataccgagg tattgccgcc gtatatggtg       600
     aaccgtgaca gtatgacagg aaccggtcaa ctgcctaaat ttgaagaaga cgcgtttcag       660
     attcgtgaag aggattattt ccttattccg actgcagagg tccctgtaac aaacatgcat       720
     cgcgatgaaa ttctgacagc ggatgagctc ccaatcgctt actctgcctt cagcgcatgt       780
     tttcgttctg aggcgggatc tgccggacgt gatacgagag ggctgatccg tcagcaccag       840
     tttaacaagg tggaactcgt acgctttgtg aagccggagg attcgtatgc ggagctcgaa       900
     aaattgaccg gtcatgcaga aaaaatcctc caacaactga atctgccgta ccgagttttg       960
     aatatgtgca cgggggacct cggttttaca gcggcaaaga agtacgatat tgaagtgtgg      1020
     ctgccaagct atggcgaata taaagagatt tcttcatgca gtaattttga agactttcag      1080
     gcgcggcggg cgaatattcg cttcaagcgc gatcagaaag gtaaggcgga attcgtgcat      1140
     acgctgaacg gatccggtct ggccatcggc agaacggttg cggcgattct cgagaactac      1200
     cagcaagccg acggcacgat taaaattcca aaggttcttc agccgtatat gggtggaaaa      1260
     acgcgaattg gctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page