(data stored in ACNUC7421 zone)

EMBL: CP001791.PE141

CP001791.PE141       Location/Qualifiers
FT   CDS_pept        153277..154107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0144"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: sat:SYN_00209 ABC-type cobalt transport
FT                   system, ATPase component; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97693"
FT                   /db_xref="GOA:D6XVS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADH97693.1"
FT                   /translation="MDRKITVDHVYFKYADDSPDVLRDVSLTIKDGEWVTILGPNGSGK
FT                   STLARLFNALILPDRGAVTSLGIDTADEKHWPALRRQVGMVFQNPDNQLVAPTVADDVA
FT                   FGLENAGIPLEEMKTRVKESIATFGLSGLENAEPHRLSGGQKQRVAIAGVMALAPDVII
FT                   FDEATSMLDPEGKREVWAAMDKLRKDQAITLISITHDVSEAVKADRVIVMHEGGILKEG
FT                   TPASVLGDQEVMHTAKLKPPFPQTVAAELLKAGIDVPESILTEEELIKALWTSM"
     gtggaccgta aaatcaccgt ggatcacgtg tattttaaat atgccgatga cagtcccgat        60
     gtccttcggg atgtatcact gaccattaaa gacggggaat gggtcaccat tctcggtccg       120
     aatggctccg gcaagtccac gcttgccaga ctctttaatg cgctgatctt gcctgacagg       180
     ggggcggtga cgagtctcgg gattgatacg gcagacgaga agcactggcc ggcccttcgc       240
     aggcaggtcg ggatggtctt tcagaatccc gataatcagc tcgtcgcgcc aaccgttgcc       300
     gacgacgtgg ctttcggcct tgagaacgca gggattcccc ttgaggagat gaagacgcgt       360
     gtgaaagaga gcatcgcgac ctttggcctt tcagggctcg agaacgctga gccccaccgt       420
     ttatcgggcg gtcaaaagca gcgcgtcgcc attgcagggg tcatggccct cgccccagat       480
     gtgatcatct ttgatgaggc gacgtccatg ctcgacccgg aaggaaagcg ggaagtgtgg       540
     gcagcgatgg acaagctccg gaaagaccag gccatcaccc tcatcagcat cacccacgat       600
     gtgtcggaag ccgtaaaggc ggatcgggtc atcgtcatgc acgaaggcgg tatcctgaaa       660
     gaaggcacgc ctgcgagtgt tctcggtgat caggaggtca tgcatacagc caagcttaaa       720
     ccgccgttcc cgcaaacggt tgccgcagaa ctgttaaaag cgggtatcga cgtgcccgaa       780
     tcgattctta cggaagagga gctgatcaag gcgctatgga catccatgta a                831
//

If you have problems or comments...

PBIL Back to PBIL home page