(data stored in ACNUC7421 zone)

EMBL: CP001791.PE143

CP001791.PE143       Location/Qualifiers
FT   CDS_pept        154981..155787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0146"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: sat:SYN_00208
FT                   ABC-type cobalt transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97695"
FT                   /db_xref="GOA:D6XVS2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:D6XVS2"
FT                   /inference="protein motif:PFAM:PF02361"
FT                   /protein_id="ADH97695.1"
FT                   /translation="MFDSIIIGQYVPGDSVVHRLDPRVKLTAVFIFLVFMFMTRDPLLL
FT                   TVAVLLSFGGLLASRVPLSFYAKGMRFISIIIVLTFVLHLFMTGGGEVIVELPFATIYS
FT                   GGLIEGFMLAMKLAMIITIASLLTLTTTPIDLTDGMERMLAPFKRVKLPTHELALMMSI
FT                   ALRFIPTLIEETRTIVLAQLARGTNFSEGSLWKRLKALIPILVPLFTQSFKRAEELATA
FT                   MEARGYAGGEGRTKYRQLHWGLKDSVVLAVFLLFAAAVMAERFMGG"
     atgtttgatt caatcataat cggacaatac gtgccaggtg attccgtcgt gcaccgtctc        60
     gatccgcggg tgaaactgac ggcggtgttc atctttctcg tctttatgtt catgacccgg       120
     gatcctttgc ttctcacggt ggcggtgctg ctctcctttg gcggtcttct tgcatcaaga       180
     gtgccgctgt ccttttacgc aaaagggatg cggttcatct ccattattat cgtcctgacc       240
     ttcgtgttgc atctgtttat gaccggaggc ggcgaggtta ttgtggagct gccctttgcg       300
     accatttaca gcgggggtct gattgaaggg tttatgctcg cgatgaagct cgcgatgatt       360
     attacaatcg catcactttt gactttgaca acgacgccca tcgatttgac ggacgggatg       420
     gagcggatgc tcgccccgtt taaacgcgta aagctgccga ctcatgagct tgcgttgatg       480
     atgtccattg cccttcggtt tatcccgact ctcatcgaag agacgagaac gatcgtcctc       540
     gcgcagctgg cgaggggaac gaacttctcg gaagggtccc tgtggaaacg cctgaaggcg       600
     ctgatcccga ttcttgtgcc gctctttacc cagtccttta aacgggcgga ggaacttgca       660
     acggccatgg aagcgagagg ctatgccgga ggcgagggac ggacaaaata ccgacagctg       720
     cactggggcc tgaaggacag cgttgtcctg gcggtctttc tgctgtttgc cgcagcggtc       780
     atggccgagc ggttcatggg cggctga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page