(data stored in ACNUC7421 zone)

EMBL: CP001791.PE148

CP001791.PE148       Location/Qualifiers
FT   CDS_pept        159696..161138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0151"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97700"
FT                   /db_xref="GOA:D6XVS7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVS7"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADH97700.1"
FT                   /translation="MQSFLFFIIAVPTVLVALVLGYVWLRIRYRTARSNEALVITGPRL
FT                   GEGTDVFRDEEGRSMKIIRGGGYRLRQFQRSTPIDLKSFKLEIDTPIVITNGGVPIVAN
FT                   AIAMVKVADTLEGVARYAEQFLGKDQKQIENEISEVLSSNLRAILSKMTVEAINEDRES
FT                   FNEQVTDVAQNQLDQMGFKITSLGLSDLRDGNEENGYLENLGRPRIAKVRKDAEIAEAN
FT                   TLRETRIHKAQTDQEIQEEEYSREQEIAAAKKEKDIQEAQFKEETERARAKSEQSYELE
FT                   KAKLDKEVKEEELNIQYMERTRAVELEEQENRVKQAKADADYYAVTKKAEADANRVRID
FT                   GEASAKIKLEDGKAEAQVILERGKAEAEAREILAKAMDEHGDAILRERMIEMLPQLAAE
FT                   FAKPLSSIDSVKVIDSGSGNGVSSVGGSVARSMMEMSEPLKETTGIDLKDLLSKFTDQT
FT                   GKENKTDSGGGSEQKEKKEDGH"
     atgcaatcat ttttattttt catcattgcg gtgcccaccg tcctcgtcgc ccttgtactt        60
     gggtatgtgt ggctcaggat ccgttaccga acagccaggt cgaatgaggc gctcgtcatt       120
     acaggtccgc ggcttggaga aggcacggac gtcttccggg atgaggaagg ccgttcgatg       180
     aagatcatcc gcggcggcgg ctaccgcctg cggcagtttc agcgttcgac cccgattgat       240
     ctgaagtcct ttaagcttga gatcgatacc ccaatcgtca ttaccaacgg cggtgtgccg       300
     attgtggcga atgcgattgc catggtcaag gtcgccgata cccttgaagg agtggcccgc       360
     tacgcggaac agttcctcgg caaggatcaa aagcagattg aaaacgaaat ctccgaggtg       420
     ttgagcagta atctgcgtgc gatcctctca aagatgaccg tggaagcgat caacgaagac       480
     cgggagtcct ttaatgagca ggtcacggat gtggcgcaaa accagctcga tcagatgggc       540
     tttaagatca cttctctcgg tttgtcggat ctgcgtgatg gtaatgaaga gaacgggtat       600
     ctcgagaacc tcggacgacc gcggattgcg aaagtgcgta aagatgcaga gattgccgaa       660
     gccaatacgc tcagagagac acggatccat aaagcacaga cggatcagga aattcaggaa       720
     gaggagtaca gccgtgaaca ggagatcgca gcggcgaaga aggaaaagga catccaggag       780
     gcgcagttca aagaggagac ggaacgcgcc cgtgcgaagt cggaacagtc ctacgagctt       840
     gagaaagcga agctcgataa agaagtgaaa gaagaagaac tcaatattca gtacatggaa       900
     cgcacccggg ccgttgagct tgaagaacag gaaaaccggg tgaagcaggc gaaagcggat       960
     gccgactact atgcggttac aaagaaggcg gaagcggatg ccaaccgtgt ccgaattgac      1020
     ggggaagcct ccgcaaaaat taagcttgaa gacggtaaag cggaagcgca ggtcattctt      1080
     gaacgcggga aagcggaagc ggaggcgaga gaaatactgg ccaaagcgat ggatgaacat      1140
     ggtgacgcga tccttcgtga gcggatgatt gagatgctgc cgcagctcgc cgccgagttc      1200
     gcgaagccgc tctcgtccat tgattcggtg aaagtgattg attccgggag cggaaatggg      1260
     gtctcgagtg ttggcggctc cgtcgcaagg tccatgatgg agatgagtga gcccctgaaa      1320
     gaaacgacgg ggatcgatct gaaagacctc ctatccaaat tcacagacca gaccgggaaa      1380
     gaaaacaaga cggattcagg cgggggatct gaacaaaagg aaaagaagga agacggacac      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page