(data stored in ACNUC7421 zone)

EMBL: CP001791.PE151

CP001791.PE151       Location/Qualifiers
FT   CDS_pept        163405..163584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97703"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97703.1"
FT                   /translation="MRALFFVGSKMRSFCYTGRPRGGIIAVDPCRAERRRHCKQEAGEA
FT                   GGKRCLAKTGFENL"
     atgagggctc tttttttcgt cgggagcaag atgcggtcat tctgctatac aggtcggcct        60
     cggggcggta tcatagcggt agatccatgc cgcgcagaaa ggcgccggca ttgtaaacaa       120
     gaggcgggtg aagcaggtgg taaacgttgt ctggctaaaa cgggatttga gaatctttga       180
//

If you have problems or comments...

PBIL Back to PBIL home page