(data stored in ACNUC7421 zone)

EMBL: CP001791.PE153

CP001791.PE153       Location/Qualifiers
FT   CDS_pept        165086..166729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0156"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   reu:Reut_B5661 CdaR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97705"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT2"
FT                   /inference="protein motif:PFAM:PF07905"
FT                   /protein_id="ADH97705.1"
FT                   /translation="MEMTLADIQKLPAFEGVKLIAGHEGIDRVIRNVYFMEVPDIFGYI
FT                   DEGGFLLSTLYPIADDEAAIQRLIPGLVEVGMAGLAIKPARYITDVPDVMIEQANELGF
FT                   PLFVLGQGANLSTLTNTILETLLDKNTSTLQFRNDLHNKMMEELVNGASLTELTMTVSE
FT                   MIESPIILLDRELERITDTTGKRVKVDRESVPPLPVERSFCLPNHVLDQVRLSVGSDGE
FT                   IFLKDSFIQPVLAGEECFGYMILPTTDRQIDPNAKMALEQTSLLMASVFQRDKALKQKE
FT                   ENYLDAFIRDVLNEKMGSQFEVIEKAKLFKWDLQFPVALFNMSVRLEDVVKKRRILIQY
FT                   MENRVVEQFLSRKLDIHISKIKLIYMDDSICAFINVAFESGIDERLIGVCEELVAYLES
FT                   HDPDAPLSIGIADTVEGLGRFSKAYHEAIRTRELSEKIAEGGSFVRHYRDMVLYELIDQ
FT                   ISEDVRADFIDKRIGAVLRYDETKKMELLKTLEAFIDHDFNAQKAAASLFIHYNTFRYR
FT                   LEKLKELGVDYDSGFDWMETALACRMQKLL"
     atggaaatga cgctcgcaga cattcaaaaa ctcccggcct ttgaaggagt gaagctgatc        60
     gcaggccatg agggcatcga ccgggtgatc cggaatgtgt attttatgga ggtgccggat       120
     atattcggct acattgacga gggcgggttc ctgctttcga cgctgtaccc gattgccgat       180
     gatgaagcgg cgattcagcg cctcataccg ggactcgtgg aggtcgggat ggcgggactt       240
     gccatcaagc cggcccgcta cataaccgat gtgccggacg tgatgattga acaggccaat       300
     gaactcggct ttccgctgtt tgtccttgga cagggggcga atctgtcgac attgaccaat       360
     acgatccttg aaacactcct cgacaaaaat acgagcacgc tgcagttccg caacgatctg       420
     cacaataaaa tgatggaaga actcgttaac ggcgcatcgc tgacggagct gacgatgacc       480
     gtttcagaga tgattgaatc tccgattatt ctgttggacc gcgaacttga gcggattacc       540
     gatacgacgg gcaagcgcgt gaaggtggat agggagagcg tgccgccttt gccggtggag       600
     cgttccttct gcctgccgaa tcacgtgctc gatcaggtca gactgtcagt cgggagcgac       660
     ggggagatct ttttgaagga cagctttatt cagcctgtcc tcgccggaga ggaatgcttc       720
     gggtatatga tactcccaac aacggatcgg cagatcgacc cgaatgcaaa aatggccctc       780
     gaacagacgt cgcttctcat ggcgtcggtg tttcagcgcg ataaagcctt aaagcagaaa       840
     gaagagaact acctcgatgc ctttatccgg gacgtcttaa atgaaaagat gggttcgcag       900
     tttgaagtga ttgagaaagc gaagctgttt aagtgggacc tgcagtttcc ggtggcgctg       960
     tttaatatga gtgtgcggct tgaggacgtc gtcaaaaaac gaaggatcct catacagtac      1020
     atggaaaacc gggtggtgga acagttcctt tcaagaaagc tcgatattca catttcgaag      1080
     atcaagctca tttatatgga tgactccatc tgcgccttta ttaatgtagc gtttgaatcg      1140
     gggatcgatg agcggctgat tggagtatgc gaggaactgg tcgcctatct cgaatctcat      1200
     gacccggatg caccgctcag tatcgggatt gccgatactg tggagggact cggccggttc      1260
     tcaaaggctt accatgaagc gatccggacg agagaactct ctgagaagat tgccgagggc      1320
     ggatcgtttg tccgtcacta ccgggatatg gtgctgtatg agctgattga tcagatttcg      1380
     gaagacgtaa gggcggactt tatcgacaaa cggatcggtg cggtgctgcg ctatgacgag      1440
     acgaagaaga tggagctgtt aaagaccctt gaagccttta ttgaccatga tttcaatgcc      1500
     caaaaggccg cggcgtcgct gtttattcat tacaatacgt tccgctatcg cctcgagaag      1560
     ctcaaggaac taggtgtcga ttatgacagc ggctttgact ggatggaaac ggccctcgcc      1620
     tgcaggatgc aaaagctgtt atag                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page