(data stored in ACNUC7421 zone)

EMBL: CP001791.PE156

CP001791.PE156       Location/Qualifiers
FT   CDS_pept        169199..170761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0159"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /note="KEGG: lhk:LHK_01305 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97708"
FT                   /db_xref="GOA:D6XVT5"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT5"
FT                   /inference="similar to AA sequence:KEGG:LHK_01305"
FT                   /protein_id="ADH97708.1"
FT                   /translation="MSEQKGKGVAWFTKGDLNGFFGLFTNVLTNFLAAIGLLVFAINMP
FT                   GEIVYGRIVPAAALSIGIGSIIFAIQAKRLSEREGRTNVTALPYGLSVPHYFVVAFAVM
FT                   LPVYAMSGDWMLAWAVGIAWNVVQGIIMTIGAFIGPFIRKYIPRAAMLASLAGIALTYI
FT                   AMNPAGEVYTTPYIGLLTLTIVLAGWLAQKSLPFKMPAGLLAIVIGMIIAWSTGYMDVA
FT                   EVQSAAAEFSPALPLLAISMIPQGFAFLAPFLAAAIPLGIYDFLESLDNIESAEADGDK
FT                   YATVPTMLVPASLTLFGAALGSVYPTIIYIGHPGWKKAGARAGYSMATGIGALVVGFLG
FT                   IMPLVLSFIPLVALLPILIYITMVIGAQTFNETPRRHYPALIIALMPFIASYVITQIDN
FT                   ALGAMGTSAAEVGYETLADAGIPYLGWQAFGAADILVAMILATIVIYIIDRNFRYALVY
FT                   ALIAAVLSFFGVIHAPEIGIGQGLNAALGYLSMSVALLAMMFYRPEENRTEDVSALEEL
FT                   DQS"
     atgtctgaac aaaaaggaaa aggggtcgcc tggtttacga aaggtgacct gaacggattt        60
     ttcggtttat ttacgaatgt actgacgaat tttcttgccg cgatcggttt gctcgttttc       120
     gccatcaaca tgccgggtga gatcgtgtac ggccggattg tccctgccgc agcactgtcg       180
     atcgggatcg gctcaatcat ctttgccatt caggcgaaac ggctgtctga gcgggagggc       240
     agaacgaacg tcaccgccct gccatacggg ctgagtgtac cacactattt cgtcgtagcc       300
     tttgccgtca tgttgccggt gtacgcgatg agcggcgact ggatgcttgc ctgggctgtc       360
     gggattgcct ggaacgtcgt gcaggggatc atcatgacga tcggggcctt tatcgggccg       420
     ttcatccgaa agtacatccc gcgagcggcg atgcttgcgt ccctggccgg gattgcgttg       480
     acctacatcg ccatgaatcc ggctggtgag gtatacacga cgccgtatat cggtcttctg       540
     accctgacga ttgtcctcgc cggctggctc gcgcaaaagt cactgccgtt taagatgcct       600
     gccggactgc tcgcgattgt catcgggatg atcattgcct ggtccaccgg ctacatggac       660
     gtcgcagaag tccagtctgc agccgctgag ttctctccgg ccctgccgct ccttgcgatc       720
     tcgatgattc cacaggggtt tgccttcctc gcaccgtttt tggccgcagc gatccccctc       780
     gggatctatg attttcttga gagtctcgat aacatcgaga gcgccgaggc ggatggggat       840
     aaatatgcca ccgttccgac gatgctcgtg cctgcaagtc tgactctctt tggcgcagcc       900
     ctcggaagcg tgtatccgac gatcatttac atcggtcacc cgggttggaa gaaggcaggt       960
     gcgagagcgg gttattccat ggcgaccggg atcggggcac tcgtggtcgg attcctaggc      1020
     atcatgccgc tcgtattgtc cttcattccg ctcgtggccc tgttgccgat cttgatctac      1080
     attacgatgg tcatcggtgc acagaccttt aatgaaacac caagacgcca ttatccggcg      1140
     ctgatcattg cgcttatgcc gttcattgca agctacgtca tcacgcagat tgacaacgcc      1200
     cttggcgcga tgggaacctc agcggcggaa gtcgggtatg aaaccctggc ggatgcgggg      1260
     atcccgtatc tcggctggca ggcattcggt gctgcggaca ttctcgtcgc gatgattctc      1320
     gcaacgatcg tcatttatat catcgaccgc aacttccgct acgcccttgt ctacgcttta      1380
     atcgcagctg tgctctcgtt cttcggtgtg atccatgccc ctgaaatcgg tattggtcaa      1440
     ggcctgaatg ccgcacttgg gtacctgagc atgtccgttg ccttgttggc aatgatgttc      1500
     taccggccgg aagagaatcg cacggaggat gtatcagctc ttgaagagct cgatcagtca      1560
     tga                                                                    1563
//

If you have problems or comments...

PBIL Back to PBIL home page