(data stored in ACNUC7421 zone)

EMBL: CP001791.PE158

CP001791.PE158       Location/Qualifiers
FT   CDS_pept        171584..173143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0161"
FT                   /product="FdrA family protein"
FT                   /note="PFAM: FdrA family protein; KEGG: ecd:ECDH10B_0307
FT                   acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97710"
FT                   /db_xref="GOA:D6XVT7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVT7"
FT                   /inference="protein motif:PFAM:PF06263"
FT                   /protein_id="ADH97710.1"
FT                   /translation="MEKQVIIRKNAYYDSVTLMSLASKIEQLDGVHDAIVAMATAMNKE
FT                   LAGDIGLVTDEVEAAGDNDLLLAVSAENEKALEEAFTAIEAAFEAKSSQANKQTEKTYT
FT                   NTKEALRDHEEANLAIISVSGEFAAREAEIALKKGLHVMIFSDNVSVEDERRLKELGRN
FT                   KGLFVMGPDCGTAILNGTGLCFANSVRRGNIGLVAASGTGLQEVTVQIDRLGGGVSQGI
FT                   GTGGRDLSKDIGGLMMLQGIKALEEDPDTDVIVLISKPPAKEVQDLVLEQVKASRKPVV
FT                   ISFIDGDPAAAVSAGAIFGYSLTDTAIKAVALSKGEEAPDKPADQFDKEAWETVLNGVR
FT                   EKRSDSQIDIRGLYGGGTLCAEALSIMRQEGLSVKSNVAKREEEKLFNTRESEGHVLLD
FT                   LGEDEFTVGKPHPMIDPTTRNQRLLQEAADEKTAVILMDFELGYGSHEDPVGVSLPFIE
FT                   EARVNNPSLAIVSYVCGTATDPQGLESAESRLREAGVAVANSNVEAVRLAVHLQAAREV
FT                   SA"
     atggaaaaac aggtgatcat cagaaagaat gcgtactatg attctgtcac actcatgtca        60
     ttagccagta aaatcgaaca gctcgacggc gtccatgacg ccatcgttgc catggcgacg       120
     gcgatgaata aagaactggc cggtgatatc ggtctcgtca ctgacgaggt ggaagcggca       180
     ggggataatg atctccttct cgctgtatcg gcagagaatg aaaaagcgct ggaagaggcg       240
     ttcacagcca tcgaggcagc gtttgaggcg aaatcatcac aggcaaataa gcagacagaa       300
     aagacgtaca cgaacacgaa agaagccctc cgtgatcacg aagaggcgaa tctggcgatt       360
     atatccgtat ccggtgaatt tgccgcaaga gaagcggaga ttgccctgaa gaaagggctt       420
     cacgtcatga tcttcagtga caacgtatcg gtggaggatg agcggagact caaagaactc       480
     ggacgcaaca agggactgtt cgtcatggga cctgactgcg gaacggcgat tctcaatggc       540
     acgggactct gttttgccaa cagcgtacgc cgggggaaca tcggccttgt tgccgcatcg       600
     ggaaccggcc ttcaggaagt gaccgtgcag atcgatcgcc tcggcggcgg cgtttcgcag       660
     ggtattggca ccggcggccg ggatctctcg aaggacattg gcggcctgat gatgcttcag       720
     gggatcaaag ccctcgaaga agatccggac acggacgtga ttgtactgat ctcaaagccg       780
     ccggcaaaag aagtgcagga cctggtcctt gaacaggtga aggcgtcaag aaagcccgtg       840
     gtcatctcct tcattgatgg agatcctgcg gcagcggttt cggcaggggc gatcttcggc       900
     tactccctga cggataccgc gatcaaagcc gtggctctct caaaaggaga agaagcaccg       960
     gacaaaccgg cggaccagtt tgacaaggaa gcgtgggaaa cggtcctgaa cggcgtgagg      1020
     gagaaacgaa gcgatagcca gatcgatatc cgcggtctgt acggtggcgg cacactctgc      1080
     gccgaagctc tctcgatcat gcgtcaggaa ggcttaagcg ttaagagcaa cgtggcgaag      1140
     cgcgaggaag agaagctctt caatacccgg gagagtgaag gacatgtcct gcttgatctc      1200
     ggcgaagacg agttcaccgt aggcaagccg catccgatga ttgatccgac gacacggaac      1260
     cagcgcctcc tgcaagaagc agcggatgag aagacggcgg tgattctgat ggacttcgaa      1320
     ctcggctacg gatcgcacga agaccctgtc ggtgtcagcc tgccgttcat cgaagaagca      1380
     cgggtgaaca acccgtcgct tgcgatcgtc tcttatgtat gcggaaccgc cactgatcca      1440
     cagggacttg aatcagcaga atcgcgcctg agagaagcgg gtgtcgccgt cgccaacagc      1500
     aatgtggaag cggtccggct cgccgttcat ctgcaggcag ccagggaggt atcagcatga      1560
//

If you have problems or comments...

PBIL Back to PBIL home page