(data stored in ACNUC7421 zone)

EMBL: CP001791.PE162

CP001791.PE162       Location/Qualifiers
FT   CDS_pept        176910..178595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0165"
FT                   /product="choline dehydrogenase"
FT                   /note="KEGG: dal:Dalk_0705 choline dehydrogenase; TIGRFAM:
FT                   choline dehydrogenase; PFAM: glucose-methanol-choline
FT                   oxidoreductase; FAD dependent oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97714"
FT                   /db_xref="GOA:D6XVU1"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU1"
FT                   /inference="protein motif:TFAM:TIGR01810"
FT                   /protein_id="ADH97714.1"
FT                   /translation="MSEKYDVVIIGGGSAGCVMANRLSEDENRSVLVLEAGRKDFSWDL
FT                   LIQMPAALPFPAGKSLYDWKYESDPEPYMGQRRISHARGKVLGGSSSINGMIYQRGNPL
FT                   DYERWGKDPGMENWDFAHCLPYFKRLESALGSDKDDPYRGHDGPLKLERGPAKNPLFQA
FT                   FFDAAVEAGYNRTPDVNGFRQEGFGPFDKHLYKGRRMSASRAYLQPVMKRKNLTVKTRA
FT                   FVSSIDFEGKRAKGVTYKRNGKVHQIEAGEVILAGGAINTPQMLQLSGVGDAQHLRSLG
FT                   IKPVVDLPGVGENLQDHLEAYIQYSCPKPVSEQPNLSLHRMPWIGLQWIFARKGAAATN
FT                   HFEGGGFVRSNDIVDYPNLMFHFLPVAVRYDGTKADTKHGFQVHVGPMYSDARGSLKIT
FT                   SKDPRKHPSMVYNYLSTEQDRREWIEAVRISRNIMAQDAIKPYNSGEIAPGPEVQTDDE
FT                   ILEWVAKDAETALHPSCTAKMGPASDPMAVVDPESMKVHGLENVRVVDASAMPYVTNGN
FT                   IHAPVLMLAEKAADLIRGKKPLEPEHLDFYRHGVHPADAGVEKK"
     atgagtgaaa agtatgatgt cgtgattatt ggtggaggaa gcgcggggtg cgtcatggca        60
     aaccgcttga gtgaagatga gaaccggagt gtcctagtcc ttgaagcggg gcgtaaggat       120
     ttctcatggg atttactgat tcagatgccg gcggcactgc cgttcccggc ggggaagtcg       180
     ctctatgact ggaagtatga atcggaccct gagccttata tgggccagcg tcgcatcagc       240
     catgcccgcg gcaaggtcct cggcggatca agctccatca acggcatgat ctatcagcgc       300
     ggtaatccgc tcgactatga gcgatggggc aaagatccgg gtatggagaa ctgggatttt       360
     gcccactgcc tgccgtactt caagcgcctt gaatctgcgc tcggttctga caaggatgat       420
     ccgtatcgcg gtcatgacgg tccgttgaag cttgaacgcg gaccggcgaa gaatccgctt       480
     ttccaggcgt tttttgacgc ggcagtcgaa gcgggctaca accgcacacc tgacgtgaac       540
     gggttccgcc aggaaggctt tggtcccttt gacaagcact tgtataaagg ccgccgcatg       600
     tccgcatcac gcgcgtattt gcagccggtc atgaagcgga agaacctgac cgtaaaaacc       660
     cgtgcgttcg tgtcgagtat cgactttgag ggcaagcgtg cgaaaggcgt gacctacaag       720
     cgtaacggca aggtgcatca gattgaggca ggcgaagtga ttctcgccgg cggtgcgatc       780
     aacacgccgc agatgcttca gctttccggt gtcggtgacg cgcagcatct gcgttccctc       840
     ggtatcaagc cggtcgtcga tctgccgggt gtcggggaga acctgcagga tcaccttgaa       900
     gcctatatcc agtactcgtg cccgaagccg gtctctgagc agccgaacct gagcctgcac       960
     cggatgccgt ggattggcct gcagtggatc ttcgcacgta aaggtgccgc agcgacgaac      1020
     cactttgaag gcggcggatt cgtgcgctcc aatgacatcg tcgactatcc gaacctaatg      1080
     ttccacttct tgccggtagc cgtccgttat gacggtacga aggcagatac gaagcacggt      1140
     ttccaggtcc acgtcggccc gatgtattcc gacgcgcggg gttctttgaa gatcacgtcc      1200
     aaggatccgc gcaagcatcc gagcatggtc tacaactacc tttccacgga acaggaccgc      1260
     cgcgagtgga tcgaagcggt acgcatttcc cggaacatca tggctcagga cgcgatcaag      1320
     ccgtataact ccggcgagat tgcccctgga cctgaagtcc agaccgatga cgagatcctc      1380
     gaatgggttg caaaagatgc cgaaacggct cttcacccgt cctgcacagc caagatggga      1440
     cctgcatccg atccgatggc cgtcgtcgat ccggagagca tgaaagtgca cggccttgag      1500
     aacgtccgcg ttgtcgatgc gtctgcgatg ccgtatgtca cgaacggcaa catccacgca      1560
     ccggtcctta tgcttgctga aaaagcagcg gaccttatcc gcggcaagaa gcccctggag      1620
     ccggaacacc tcgatttcta ccgtcacggt gttcacccgg ccgacgcagg tgtggaaaag      1680
     aaataa                                                                 1686
//

If you have problems or comments...

PBIL Back to PBIL home page