(data stored in ACNUC7421 zone)

EMBL: CP001791.PE163

CP001791.PE163       Location/Qualifiers
FT   CDS_pept        178930..179853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0167"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: pen:PSEEN2341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97715"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU2"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADH97715.1"
FT                   /translation="MPDRLIVLNKDEDTLSIVNADTGMTEKTVATSHNPHELVVSRDGL
FT                   KTYIACSLGNTVDILDNRTFEIVRHLTHPDFDFPHGLGLTNDGKKLYLASTFSEKVFII
FT                   DTKTDEIESVTKTGQKLSHMISFSPDGNTVYIPNIGSHNLTVMDTDTETITTHIPVGKG
FT                   PEGVAVHPDGRHLYVANQEEDTLHILDTESHEVLYKRRVGHVPVRLVFSPDGKYALIAN
FT                   RESNDVSIIDTAQHINGETRPWEIKRLPVGVWAGGIVFSPDGQKAYVANNKTNDVSVID
FT                   MTTLKEERRFDVGIHPDGIAYLEKRT"
     atgccagaca gactgattgt actgaacaaa gacgaagaca cgctttccat cgtgaatgcg        60
     gatacgggaa tgacagaaaa aacggtggcg acgagtcaca accctcatga gcttgtcgtg       120
     agccgtgacg gcctgaagac gtatatcgcc tgttcactcg ggaacacggt ggacatcctc       180
     gataaccgca cgtttgagat cgtcaggcac ctgacgcatc cggattttga tttcccgcac       240
     ggcctcgggc tgacaaacga cggcaaaaag ctctatctcg cgtcgacgtt cagtgagaaa       300
     gtattcatta ttgatacaaa gaccgacgag atcgaatcgg tcacaaaaac aggtcagaag       360
     ctctcacata tgatcagctt ctcacccgac gggaacaccg tctacatccc gaacatcggc       420
     agtcataacc tgacggtcat ggatacggac acggagacga tcacgaccca tatccctgtc       480
     ggcaaagggc cggaaggggt ggcggtgcat ccggatggac ggcaccttta tgtggcgaat       540
     caggaggagg ataccctcca catcctcgat acagaatcac acgaggtcct ctacaaacgc       600
     cgggtcggtc atgtgccggt caggctcgtc ttctcacctg acggcaaata cgccctgatt       660
     gcgaaccggg aatcgaacga cgtctccatc atcgataccg cccagcacat caacggcgag       720
     accaggccct gggagatcaa gcgcctgcct gtcggcgtct gggccggtgg gatcgtcttc       780
     tctccggacg gccaaaaagc ctatgtggcc aataacaaaa caaacgacgt ctcggtgatc       840
     gacatgacca ccctgaaaga agagaggcgc tttgacgtcg ggattcaccc tgacgggatt       900
     gcgtatctcg aaaagcgcac ataa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page