(data stored in ACNUC7421 zone)

EMBL: CP001791.PE165

CP001791.PE165       Location/Qualifiers
FT   CDS_pept        complement(180996..181547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0169"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: rpf:Rpic12D_4272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97717"
FT                   /db_xref="GOA:D6XVU4"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU4"
FT                   /inference="protein motif:COG:COG1510"
FT                   /protein_id="ADH97717.1"
FT                   /translation="MTDSYEEQRKKIEKAKDKVIGSISETMDLYGVTPAAGNLYATMYF
FT                   KDQMTLDEMREELQMSKPSMSTSVRKLQEIDMVKKTFTRGSRKHTYIAEKDFFRFFKTF
FT                   YSEMWEREAKVNLESVESAQEDLVEIMKDANSTPDIVAESKQYYDQLEESKTYYNWLYD
FT                   LAKAIRSGEIFDMIPRDTDR"
     atgaccgatt cctatgaaga acagcgcaaa aaaattgaaa aagcaaaaga taaagtcatc        60
     ggctcgattt cggaaacgat ggatttatac ggggttaccc ccgctgcggg caatttgtat       120
     gcgacgatgt actttaagga tcaaatgaca ctcgatgaaa tgcgcgagga gctccagatg       180
     agcaagccga gcatgagtac gagcgtccgc aagctgcagg agattgacat ggtgaagaag       240
     accttcaccc gcggatcgag aaagcacacg tatattgccg agaaagactt cttccgtttc       300
     tttaaaacat tctattcaga aatgtgggaa cgtgaagcca aggtcaacct cgaatccgtt       360
     gaatcggctc aggaagatct cgttgagatc atgaaggatg cgaacagcac gcctgatatt       420
     gtcgccgaat ccaaacagta ctacgatcag ctcgaagaat ccaagacgta ctacaactgg       480
     ctgtacgatc tggcgaaagc gatccgctca ggcgagatct tcgatatgat cccacgggat       540
     acggaccgct ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page