(data stored in ACNUC7421 zone)

EMBL: CP001791.PE168

CP001791.PE168       Location/Qualifiers
FT   CDS_pept        complement(183862..184464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0172"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: mca:MCA2850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97720"
FT                   /db_xref="GOA:D6XVU7"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU7"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADH97720.1"
FT                   /translation="MTTMEESTMDDQTKWNDKHARRIKSGKIPGANPVLADQIPVTENA
FT                   VAIDLACGLGANALMLADRGYTVTAFDVSDTATDFVNAKAEELGRPVKAKAMDLTSIEG
FT                   QTAVTATAPVDLAVITYYLDRDLMELVKDLIRPGGYVFIETYVSLPGMENTPVREDFKL
FT                   HPAELVNSFEDWGIMYFDFDETNGTQTILVRKKTTHH"
     atgacaacga tggaggaatc aacgatggac gatcagacaa aatggaacga caaacacgct        60
     cgacgcatca aatccggtaa gattccgggt gcgaatccgg tcctcgccga tcagatcccg       120
     gtgacagaga acgccgttgc catcgatctc gcctgcggcc tcggggcgaa cgccctgatg       180
     ctcgcagacc gcggctacac ggtgacggcc tttgatgtgt cggatacggc aacggatttc       240
     gtcaacgcca aggctgagga gctcgggcgt cctgtaaaag ccaaagcgat ggatctcacg       300
     tccatcgaag gccagaccgc cgtgacagca acggccccgg tggatctcgc cgtcatcact       360
     tactacctcg accgggatct gatggagctc gtcaaagacc tcatccgccc cggaggctac       420
     gtcttcattg aaacgtacgt ctctctccca ggaatggaaa acacccccgt gcgtgaagac       480
     tttaagctgc atcccgccga actcgtgaac agcttcgagg actgggggat catgtatttc       540
     gacttcgacg aaacgaacgg aacccagacg attctcgtcc ggaagaaaac gacccaccat       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page