(data stored in ACNUC7421 zone)

EMBL: CP001791.PE170

CP001791.PE170       Location/Qualifiers
FT   CDS_pept        186442..187095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0174"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="KEGG: mxa:MXAN_0609 PAP2 family protein; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97722"
FT                   /db_xref="GOA:D6XVU9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVU9"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADH97722.1"
FT                   /translation="MHTNHWLTRQPLFLSTGVAFFILSMLSIVGLFDAIDLAVMDWVYH
FT                   SAPAFLTNAMTVITEFGSVELIAVMSILVLGLLLYQRRIRDMILFVAVSGGGLAVNLGL
FT                   KFLFQRERPGELNMIDAFGIELAIPSYSYPSGHTMRAAILVLLIIYLLGTWVKRREQTR
FT                   LVTTAGLLLLTLVAASRVLTGAHFPTDAVGAVLASVAFVSLCVRLYEQRWRKPS"
     atgcacacga accactggct gaccagacaa cccttgtttc tctcaacggg ggtcgctttt        60
     tttatcctgt cgatgctctc catcgtcggg ctgttcgacg ccatcgacct cgccgtcatg       120
     gactgggtgt accacagtgc cccggccttt ctgacgaacg ccatgaccgt catcacagag       180
     ttcggctcgg tggaactgat cgccgtgatg tccattcttg tcctcggact cctcctctat       240
     cagagaagaa tccgggacat gatcctcttt gtcgccgtct ccggcggagg gcttgccgtc       300
     aacctcggcc tgaagttcct ctttcagcgg gagaggcccg gggaactgaa catgatcgac       360
     gccttcggga tcgagctcgc gatcccgtcc tacagctacc cgagcggcca cacgatgcgg       420
     gcggcgattc tcgtcctgct catcatctac ctccttggca cgtgggtgaa aagaagagaa       480
     cagacacggc ttgtgaccac ggcgggactc cttcttctca cactggttgc cgcgagccgc       540
     gtcctcaccg gggcccattt cccgacggac gccgtcggtg ccgtcctcgc atccgttgcc       600
     ttcgtctccc tctgtgtccg gctctatgag caaagatggc gaaagccttc gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page