(data stored in ACNUC7421 zone)

EMBL: CP001791.PE175

CP001791.PE175       Location/Qualifiers
FT   CDS_pept        complement(190405..191556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0179"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; KEGG: ftf:FTF1168c
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97727"
FT                   /db_xref="GOA:D6XVV4"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV4"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADH97727.1"
FT                   /translation="MKNKIYIQGGTVYNADGAPIRQPLITVNSGIIEQITEGGEPPEGA
FT                   DVLRLDGDDVILPGFIDIHIHGSHGADVMDATPEALATISRSITNEGVTSFLATTITAP
FT                   AASIEEALQQVASSEGTDGARCLGVHLEGPFINAKQAGAQPVGAILDPDAGQFKHWQAL
FT                   SGNQIRIATIAPERPGGAELVQALADSGVIGSIGHSDASSADVRAAEQDGLRHATHLFN
FT                   GMRGLHHREAGVVGGVMLSDNLKAELILDHVHVSPDAARVAYQALGANRLMLITDAMRG
FT                   KGLGDGVFDLGGQEVTIEGKEARLKNGALAGSVLTMDEAVRNARSTFNASWHDIARMTS
FT                   YNQAESLGLTGTKGTIQTGADADLTVMSRTGFIKHTIIGGEKP"
     ttgaagaata agatttatat acagggcggc accgtctata acgcagacgg cgcgcccatc        60
     agacagcctt tgattacggt aaacagcggc atcatcgaac agatcacgga aggcggcgaa       120
     ccgccagaag gggccgacgt cctccgtctt gacggggatg acgtcattct cccgggcttt       180
     atcgacatcc atattcacgg cagccacgga gccgacgtca tggatgccac acccgaggcc       240
     ctcgccacca tcagccgctc catcacgaat gaaggggtga cgtccttcct cgcgacgacg       300
     atcacggcac ccgctgcgtc cattgaagag gcgctccaac aggtcgcttc ctctgaggga       360
     actgacgggg caaggtgcct tggcgtgcac ctcgaaggcc cgttcatcaa cgccaaacag       420
     gcaggcgccc agcccgtcgg cgccatcctc gacccggatg ccggacagtt caaacactgg       480
     caggccctct ccggcaatca gatccggatc gccacgatcg ctcctgagcg acccggtggc       540
     gctgagctcg tacaggcact cgcggactcc ggcgtcatcg gctccatcgg ccactccgac       600
     gcctcgtccg ctgacgtgcg ggccgcagaa caggacggac ttcgccacgc cacccatctc       660
     tttaacggca tgcggggtct ccatcaccgg gaagccggtg tcgtcggcgg cgttatgctc       720
     agtgacaact taaaagccga gctgatcttg gatcacgtcc acgtgagccc tgatgcggct       780
     cgggttgcct atcaggcact cggagcgaac cggctcatgc tcattaccga tgccatgcgc       840
     ggcaaaggcc tcggcgacgg ggtcttcgac ctcgggggac aggaagtcac gatcgaaggg       900
     aaagaagccc gtctcaagaa cggcgccctt gccggcagcg ttttgacgat ggacgaggcg       960
     gtgcgtaatg cacggtcgac cttcaacgcc tcttggcacg acatcgcacg gatgacgtct      1020
     tacaatcagg ccgagagcct cggcctcacc ggtacgaaag gaaccattca aaccggcgcg      1080
     gatgccgacc tgaccgtcat gagccgcacc ggattcatca aacacacgat tataggagga      1140
     gaaaaaccat ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page