(data stored in ACNUC7421 zone)

EMBL: CP001791.PE178

CP001791.PE178       Location/Qualifiers
FT   CDS_pept        193431..194756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0182"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG: vpa:VP2634
FT                   6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97730"
FT                   /db_xref="GOA:D6XVV7"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV7"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADH97730.1"
FT                   /translation="MAVNIAVIGGGSSYTPEIIEGLIDRYDDMPVRKITLVDVEEGQEK
FT                   LNVITNLAKRMIARSGKEISIVSTLDLEQALKGADFVTSQIRVGGLDARSMDEAIPLRK
FT                   GLVGQETNGAGGIFKAFRTIPVLMELSQAMAKICPDAWLINFTNPAGMVTEALLKYGSH
FT                   KKVIGVCNIPFNMRSGIAEMFHVPVGEVEIEFIGLNHFIFGRRVKIGGVDRTSEALAKS
FT                   IEKGVDYSPANIVSLGWTPELIRSLGMLPNPYHQYYFQTRDVIKKDMNLLDTEGTRADV
FT                   VKGVEASLFETYRAPDLDVKPKELEQRGGAYYSDAACNLMVSLHTDRQDVQTVNTLNQG
FT                   AVSDLPDDAVIEVNAVITEEGPKPVSVGKLPDEVRGIIQQMKHMEELTIKAAISGDYDD
FT                   AYLALVMNPLVSDEKLAKDLLDELLDAHQSFLPQFHSREENV"
     gtggccgtta atattgctgt gattggcggt ggttcaagct atacaccgga gattattgag        60
     ggattgattg accgttatga tgatatgcct gtcagaaaga ttaccttggt ggatgtagag       120
     gaaggacaag aaaaattaaa tgtcattaca aatttagcga agcggatgat tgcccgttcg       180
     ggaaaagaga tctcgattgt cagtacactg gatttggaac aggcgttgaa gggggcggat       240
     tttgtgacct cgcaaatccg cgttggtgga ctcgatgccc ggagcatgga tgaagccatc       300
     cctcttcgaa aggggcttgt cggccaggaa accaatggtg caggtggtat ttttaaagcc       360
     tttcggacga tccctgtgct gatggagctg tctcaggcaa tggcaaaaat ctgtccggat       420
     gcctggttga tcaattttac gaatcctgcc gggatggtga cagaggcatt gctgaaatac       480
     ggaagccata aaaaggttat tggtgtctgc aatattccgt ttaacatgcg aagcggtatt       540
     gccgagatgt ttcatgtgcc ggttggggaa gtggagatcg agttcattgg gcttaaccat       600
     tttatttttg gacgccgtgt gaaaatcggc ggggtcgacc ggacgtctga agcgttggca       660
     aaatccatcg aaaaaggtgt ggactattca ccggcgaata tcgtatctct cggatggact       720
     ccggagctga tccgaagcct cggcatgttg ccgaatccct atcaccagta ttatttccag       780
     acgcgggacg tcataaagaa agacatgaat ctccttgata ccgaaggaac ccgtgcggat       840
     gttgtaaaag gggtggaagc atcgctgttt gaaacatacc gtgcaccgga tcttgacgtg       900
     aaaccgaagg aacttgaaca gcggggcggt gcatactaca gtgacgcagc ctgcaatctg       960
     atggtcagtc tgcatacaga caggcaggat gtacagaccg tgaataccct gaatcaggga      1020
     gctgtctcag atctgcctga tgatgctgta attgaggtca atgccgtgat caccgaggaa      1080
     ggtccaaaac cggtgagcgt tggcaaactg ccagatgagg tacgaggaat cattcaacaa      1140
     atgaaacata tggaagaact gacgattaaa gccgcgatct caggggatta tgacgatgcg      1200
     tatcttgcac ttgtgatgaa cccgcttgtt tctgatgaga agctggccaa agacctgctt      1260
     gatgaactgt tggatgccca tcagtctttc ttaccccaat ttcattcccg agaggagaac      1320
     gtctaa                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page