(data stored in ACNUC7421 zone)

EMBL: CP001791.PE180

CP001791.PE180       Location/Qualifiers
FT   CDS_pept        196060..196383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0184"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG:
FT                   efe:EFER_3959 putative chitobiose/cellobiose
FT                   phosphotransferase enzyme IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97732"
FT                   /db_xref="GOA:D6XVV9"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVV9"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ADH97732.1"
FT                   /translation="MSEQTEQSLEEISFQIILHAGNARSDAMEGMAFAREGKFTQAHAK
FT                   LRDAEASFVEAHHVQSALLHKEAGGEGVSPSVLLIHAQDHLMTAMTVKDLAQEIVHLHE
FT                   KKA"
     atgagcgaac agacagagca gtccctcgaa gagatttcgt ttcaaattat ccttcatgca        60
     ggaaatgcga gatccgatgc gatggagggc atggcgttcg caagagaggg gaagtttacg       120
     caagcccatg ccaaactgcg tgacgcggag gcttcattcg ttgaagcaca tcatgtccag       180
     tctgctctct tgcataagga agccggcggt gaaggggtct ctccttctgt cctgcttatc       240
     catgcgcagg atcatctgat gacggcgatg acagtcaaag atctggcaca ggaaatcgtg       300
     catcttcacg aaaagaaagc ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page