(data stored in ACNUC7421 zone)

EMBL: CP001791.PE182

CP001791.PE182       Location/Qualifiers
FT   CDS_pept        197598..198509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0187"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   oan:Oant_3124 ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97734"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW1"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ADH97734.1"
FT                   /translation="MFVLGIDGGGSSTVARLADYAGNSIKTVQVGEINSTMMNKDDWIQ
FT                   SCSSILNHFESYVDRIQCIFIGLSGISRLKIETIEFLKEDLKKRIHPDAEVFIVNDAVL
FT                   GLYAGTGGEDGIVNIAGTGSQTFGLKNGVEFKIGGWGHKFDHTGSGYGIAIEGIKSVIT
FT                   AYENRSPFNYFEKAVMDAWGEDSFMEMMEKINSGSSAKQIAQLSKTICALATEDEQARR
FT                   IIDRAAHDISDAITRMSEAHFAGEKGVKVILMGGLMNQQDLFLPLLEKKLPHALLKVLD
FT                   QEPVEGAVIAGLKAVKGSENGD"
     atgtttgttt taggaatcga tggcgggggt tcatctactg ttgccagact tgctgattat        60
     gcaggtaaca gcataaaaac agtccaggtt ggtgagatca attcaactat gatgaataaa       120
     gatgattgga tacagtcctg ttcatccata ttgaaccatt ttgaatcgta tgtggatcga       180
     atacaatgta tttttattgg gttatccggt attagcaggt tgaaaattga aactatagaa       240
     tttttgaaag aggatttaaa aaaacgaatt catccagatg ctgaagtatt tatagtgaat       300
     gatgcagttc ttggattata tgcagggact ggcggagaag atggcatagt taatattgcc       360
     ggaaccggct ctcaaacatt cggacttaaa aacggtgttg agtttaagat aggtgggtgg       420
     ggacataaat ttgatcatac aggaagtgga tacggaattg cgattgaagg tattaagtca       480
     gtgattacgg catatgagaa tcgttcacca ttcaactatt tcgaaaaagc tgttatggat       540
     gcttggggag aagactcttt tatggaaatg atggagaaaa taaattcggg cagttcggca       600
     aaacagatcg cacaactatc taagactatc tgtgctttag ccactgaaga tgaacaggca       660
     agaaggatca ttgatcgtgc tgcacatgat atatcagatg caataactcg catgtccgaa       720
     gcacattttg ctggcgagaa gggtgtgaag gtaatcctaa tgggtggttt aatgaatcag       780
     caagatctgt ttttgccact tttagaaaag aagttacctc atgccttact gaaggttctt       840
     gatcaagaac ctgtagaagg ggcagtgatt gcagggctaa aagccgtgaa gggaagtgag       900
     aatggtgatt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page