(data stored in ACNUC7421 zone)

EMBL: CP001791.PE183

CP001791.PE183       Location/Qualifiers
FT   CDS_pept        198499..199647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mxa:MXAN_4187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97735"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW2"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ADH97735.1"
FT                   /translation="MVIKTGLDNLLETNIPDLKKRSVGLVINHTSIDQRKQLSLDILYR
FT                   EGCQIKAVFTPEHGFRGTADAGEHVKDDYDGKTGIPIYSLYGKQKRPAKHMLEGLDALV
FT                   FDIQDLGVRFYTYIYTLAYCMEEAAKYGLEVWVLDRPNPINGQFVEGNRVRDNFTSFIG
FT                   NYRLPVRHGMTVGELAAYFKETFKIDVDLKVVKMIGWTREMHFTDTGLHWVNPSPSATG
FT                   ETMALCYPGTCFMEGLNVSEGRGTDYPFEQIGAPWLDGEAVCNRIKNKSMPGVNLHPVS
FT                   FTPINADYMQIACGGIFLEVTDRYQFSALETSLALVDVIHEMYPGNLKVKDPIKGRFFF
FT                   DLLFGTDEARKKMNHSESLLEWMRENDESSAFKLERKPFLMY"
     atggtgatta aaacaggact tgataatttg ttggaaacga acatacctga tttgaaaaaa        60
     cgttcagtgg gccttgtaat caatcacacg tccattgatc agcgcaaaca gttgagttta       120
     gacatcctct atcgagaagg gtgtcaaatt aaagcggtat ttaccccgga acatggcttt       180
     cgaggcactg ctgatgcagg tgaacatgtt aaagatgact atgatggtaa gaccgggatt       240
     cctatctaca gtctgtatgg gaagcagaaa agaccggcaa aacatatgct tgagggcctt       300
     gatgcactcg tttttgacat acaggattta ggtgttcgct tttacactta tatttacacg       360
     cttgcgtatt gcatggaaga agcagcgaaa tatgggcttg aggtttgggt attagacagg       420
     ccgaatccga ttaatggaca gtttgtcgag ggcaatcgtg tcagggataa tttcacttct       480
     tttattggaa attatcgtct tcctgtaaga cacgggatga ctgtaggaga gcttgcagct       540
     tacttcaaag aaacctttaa aattgatgtg gatctaaaag ttgtgaaaat gatcggatgg       600
     actcgtgaga tgcactttac tgataccggt ttgcattggg tgaatccgtc tccttctgct       660
     acgggtgaaa cgatggcctt atgctatccc gggacttgtt ttatggaggg gcttaatgta       720
     tctgaaggga gaggcacgga ttatcctttt gaacagattg gtgcgccctg gctggatggt       780
     gaagcagttt gtaatcgtat aaaaaataag tcgatgcctg gagttaatct gcatccagtt       840
     agctttacgc cgataaatgc cgactatatg caaatagctt gtggaggcat ctttttagaa       900
     gtaacagaca ggtatcagtt ttcagctctc gaaacatcat tggccctggt ggatgtgatt       960
     catgaaatgt atcccggaaa tctgaaggtt aaggatccga taaagggtcg attcttcttt      1020
     gacttgttat tcggaactga cgaagcccgt aagaaaatga atcatagtga atcattgttg      1080
     gaatggatga gagaaaacga tgaatcttca gcatttaagt tggaacgtaa accatttttg      1140
     atgtactga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page