(data stored in ACNUC7421 zone)

EMBL: CP001791.PE184

CP001791.PE184       Location/Qualifiers
FT   CDS_pept        199676..200608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0189"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein; K01207 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97736"
FT                   /db_xref="GOA:D6XVW3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADH97736.1"
FT                   /translation="MHLWEDVKQQYSDQICILWNRIYGDRFPLRKSLFQQNSIEDIHVD
FT                   ADASRLVTVGDEAVGLIIVKRDHYNRFQRSQAWIHLLMVDPTYQHRGIGSKLLKQAEAT
FT                   VVNMGASEIVIGQDPYHYFPGVPADQNAIKKWLMKRGYTNVNSVSDYVNTSPQSERKLD
FT                   TENILSSDEKGKLFSFLKAYFSSRWLYEAEEYFLKGGSGSAYVIIKDQGEIIAFCKTNI
FT                   GEKPLIGSNVNWSQRFTGILGGIGPLGVHPEWRKMKLGREIVLLATRHLLNQGVGSIYI
FT                   DWTELHGFYRSLGYTSIETYDQFKKTIEI"
     atgcatttgt gggaagacgt taaacagcaa tacagtgatc agatatgtat actgtggaat        60
     cgcatttacg gagatcggtt tcccctaagg aaatccttgt ttcaacagaa cagcattgaa       120
     gatatccacg ttgatgcgga tgcctcgaga ctcgttactg ttggggacga agcagtgggg       180
     ttgattatag tgaagcgaga tcactataac agatttcaac gctctcaggc gtggattcat       240
     ttactgatgg tggaccccac ttatcagcat agaggaattg gaagtaaact gttaaagcag       300
     gcagaagcaa ctgtggtaaa tatgggggct agtgaaattg taatcggaca agacccctat       360
     cactattttc ctggtgtacc tgccgatcag aacgctataa aaaaatggct tatgaagcgt       420
     ggatacacca acgtgaacag tgtatctgat tatgtaaata cgtctcctca gagtgaaaga       480
     aaacttgata cggagaatat tctgagctca gatgaaaaag ggaaattatt cagctttcta       540
     aaggcttatt tctcgtctag atggctttac gaggcggaag aatatttctt gaaaggagga       600
     agcggaagcg cttatgtaat tataaaagac caaggggaaa ttattgcttt ttgtaaaacg       660
     aacatcggag aaaaaccttt aattggttcc aatgtaaact ggtcgcagag attcactgga       720
     atactgggtg gaatcgggcc gctcggagtg catccagagt ggcgaaaaat gaaattggga       780
     cgtgaaattg tattacttgc tacgcgtcat cttttgaatc agggagtggg ttcaatctac       840
     atagattgga cggagttaca cggattttat cgctctttag gatatacatc aattgaaaca       900
     tatgatcaat tcaaaaaaac tattgaaatt taa                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page