(data stored in ACNUC7421 zone)

EMBL: CP001791.PE185

CP001791.PE185       Location/Qualifiers
FT   CDS_pept        200665..201573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0190"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="KEGG: plu:plu0403 N-acetylmuramic acid-6-phosphate
FT                   etherase; TIGRFAM: glucokinase regulatory-like protein;
FT                   PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97737"
FT                   /db_xref="GOA:D6XVW4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVW4"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ADH97737.1"
FT                   /translation="MTINLSDLTTERRNERTKHIDQLSSFEILSMINEEDHLIAESVKK
FT                   EMKAINNVVEVVCERFKKGGKLVYIGAGTSGRIGVLDAAEAPPTFRTDPEMIQALIAGG
FT                   DQAMFHAIEGAEDSKEQAKQDLERLNLSKDDVIIAIAASGRTPYAKGAVEYGNEINAVT
FT                   VGLSCNKGSELSALAQLAIEVEVGPEVITGSTRMKAATAQKLVLNMISTSSMILIGKIF
FT                   ENLMVDLKASNHKLQERAKSITSAITGCSEEEVEQTLIKADFEVKPAIVMLKTGVSLVE
FT                   AKEKLKQHRGFVRKAIESQSK"
     atgaccatca atttatcaga tttaacaact gaaaggcgta atgaacgtac taaacatatt        60
     gatcaactat catcatttga aattctttcg atgatcaatg aggaagacca tcttatcgct       120
     gaatcagtga aaaaagaaat gaaagcgatt aacaacgttg tggaagtagt ttgtgagcga       180
     tttaaaaaag gaggtaaact agtctatatt ggtgccggaa cgagcggacg aattggagtg       240
     ttggatgctg cggaggcacc accgacgttc agaacagatc cggagatgat ccaggcgctg       300
     attgctggtg gtgaccaagc gatgtttcat gcaattgaag gagctgaaga ttccaaagaa       360
     caggcaaaac aggatttgga gcggttaaac ctttccaagg atgatgtcat tattgcaatt       420
     gcggcaagtg ggagaacacc ctatgcaaaa ggtgcagtgg aatacggcaa tgaaataaat       480
     gcagtaactg tcggattgag ttgcaataaa ggatcagaac tttcagcgct ggctcagctg       540
     gccattgagg ttgaggtcgg gcccgaagtg attaccggtt cgaccagaat gaaagcggct       600
     acagcacaaa agcttgtctt aaatatgatc tccacatcaa gcatgatttt gattggtaag       660
     atctttgaaa atcttatggt tgatttgaaa gccagtaacc ataaacttca ggagcgggca       720
     aaaagcatta cttctgcgat tacaggctgc tcagaagaag aagtcgagca gactttgatt       780
     aaggcagatt ttgaggtgaa accggctatt gtaatgctga aaacgggtgt atcgttagtt       840
     gaagcaaaag agaaactgaa acagcaccgt ggatttgtaa gaaaagcaat agaatcacaa       900
     tcaaaataa                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page