(data stored in ACNUC7421 zone)

EMBL: CP001791.PE19

CP001791.PE19        Location/Qualifiers
FT   CDS_pept        29753..30655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sat:SYN_01342 oligopeptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97571"
FT                   /db_xref="GOA:D6XV13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6XV13"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADH97571.1"
FT                   /translation="MATIDKAKEKELEKRAKKQSPWSIARKKFFNNKLAMISLVFLVVV
FT                   TTLAILSYWIAPFDPSRVDPTNRFTEPGGDHLLGTDGAGRDVWTLLLYGARTSLLIGFT
FT                   ATIGIVIIATVIGSVSGYYGGIVDAVLMRFTDFMMNFPFLVFVIVLASIFRDSGVFALI
FT                   LVLMVLSWTGAARVVRSKTMSEKENEYVLAAISIGGTPFKVIRKHMLPNVMTTIIVQAT
FT                   LLLAVMIVAETALSFLGFGVPQGTPSWGNMMSEASNPNVIRNYWWIWMPPGLAITFTIL
FT                   SINFIGEGIKDAFNPKSLR"
     atggctacga tagataaagc aaaagaaaaa gagctcgaga aacgggcgaa aaaacagtct        60
     ccctggtcga ttgcgagaaa gaagtttttc aataataaac tcgccatgat cagccttgtc       120
     tttttggttg tggtgacgac acttgctatc ttgtcatact ggattgcacc gtttgatccg       180
     agccgggtgg atccgaccaa caggtttaca gagcctggcg gggaccacct ccttggtaca       240
     gacggggcgg ggcgggatgt ttggacactt ctcttatacg gtgcgagaac ctctcttttg       300
     atcggtttca ccgctacgat cggtattgtg atcatcgcca cggttatcgg ctctgtttcc       360
     ggttattacg gaggtattgt ggacgctgtt ctgatgcgtt ttaccgattt tatgatgaac       420
     tttccatttt tggtgttcgt tatcgtgctg gcttccatct tccgtgattc gggcgtattt       480
     gcattgattc ttgtactgat ggtgttgtcc tggacagggg cggcccgtgt tgtacggagt       540
     aaaacgatgt ctgagaagga aaatgagtat gtcttggcgg cgatctccat tggagggaca       600
     ccgttcaagg tcatccgtaa gcatatgctg ccaaacgtca tgacgaccat tattgttcag       660
     gctacactgc tgctggccgt tatgattgta gcggagacag cgctcagttt cctcgggttt       720
     ggggttccac aggggacacc gagttggggg aacatgatga gcgaagcaag taacccgaac       780
     gtgattcgga actactggtg gatctggatg ccaccgggtc ttgcgatcac attcaccatt       840
     ttgtccatta actttatcgg tgaaggcatt aaagacgcct ttaacccgaa atcgttacga       900
     taa                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page