(data stored in ACNUC7421 zone)

EMBL: CP001791.PE193

CP001791.PE193       Location/Qualifiers
FT   CDS_pept        209547..209840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97745"
FT                   /db_xref="GOA:D6XVX2"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97745.1"
FT                   /translation="MFWSDLVAVLIGSFINALIITRLVRFMLKKWMGDGVRVATYTFSI
FT                   SFVFYMVFNYIIISDIVIVIRYILFALLLYGYDLFKERDLRIIGGVDNQIKQ"
     atgttctgga gtgatcttgt agctgttctg attggttcct tcataaatgc attaataatt        60
     acaaggttgg ttcgatttat gttgaaaaag tggatgggag acggagtgag ggtagccact       120
     tatacttttt caatctcgtt tgtgttctat atggttttta attatatcat tataagtgat       180
     atcgtaattg taataaggta tatattgttt gcattactgt tatatggata cgatttattt       240
     aaagagagag accttagaat tattggaggt gtcgacaatc aaatcaagca gtga             294
//

If you have problems or comments...

PBIL Back to PBIL home page