(data stored in ACNUC7421 zone)

EMBL: CP001791.PE194

CP001791.PE194       Location/Qualifiers
FT   CDS_pept        209959..211251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0199"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97746"
FT                   /db_xref="GOA:D6XVX3"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97746.1"
FT                   /translation="MDEQDQRKLVELYLTSTLAMIVFEEKILRDEIDNILKWLDRSSSP
FT                   QFKDNYRKFLDLFEQDMQDRIFEEIHNHRLFEGTSVFSTKSFNANKIGDFKERGKKNVR
FT                   NIFDHHDNQGNNQLNDEIELDNEKNDINVVQTLRQSFNDREAWDLLLSSVMAVIFVSNL
FT                   IYFISLVIAGSENMEGIYNELLLITAIFIVLSYNVYRNHYPYHHSTLYINPPVLSVKNN
FT                   LIIAVTGSLIANLIMVIAFYSYYDQLIDSSVDHVSEGITHEETEERDGNEQADSQISEN
FT                   ERVDDAKRNYLVSIADEMNFIYEELHYMSEYLYSDHYTLEEQIEELEFLYDVLYESAHR
FT                   PLYNDDYMRILNDYYYAIELFAIFVNTIISDIENLGYISDQEFAQQVQYYEDGVELFYK
FT                   GVEDFEFHLINLGEIDEYGVILDYYDDGDTI"
     ttggatgaac aagatcaaag aaaactggtt gagttatatc ttacaagtac attggcgatg        60
     attgtatttg aagagaagat tcttcgagat gagatcgata acattttaaa gtggttggac       120
     agatcaagtt ctcctcaatt taaagataat taccgcaaat tccttgacct gtttgagcag       180
     gatatgcagg atcgtatttt tgaagaaatc cataatcacc gcttattcga agggacaagt       240
     gtattttcta ccaaatcatt caatgcaaat aaaattggtg attttaaaga aagagggaaa       300
     aagaatgtaa ggaatatctt tgatcatcat gataatcagg gaaataatca actaaatgat       360
     gagatagaac tagacaatga gaaaaatgat attaacgtag ttcagactct aagacagtca       420
     tttaacgatc gtgaagcctg ggatttattg ttgtcatctg ttatggctgt gatctttgta       480
     tcgaatttga tctacttcat cagtttggta atagcagggt cagaaaacat ggaaggaatt       540
     tataacgagt tgttattaat taccgctata tttattgttc tcagctataa cgtttaccgg       600
     aatcattacc cttatcatca ctcgacctta tatataaatc cgcctgtttt gtcagtgaaa       660
     aacaatttga taatagcagt aactggttcg ctaattgcaa atctcataat ggtaattgct       720
     ttttattctt actatgatca attgatagat tcatcagttg accacgtcag tgaaggcata       780
     acccatgaag aaacggaaga gcgagatggt aatgaacaag cggacagtca aatctcagaa       840
     aatgaaaggg tagatgacgc taaacgaaat tatctggtga gtattgccga tgagatgaac       900
     tttatctatg aggaattgca ctatatgagt gaatatttat atagcgatca ttatactctc       960
     gaggaacaaa ttgaagaatt ggaatttctt tatgatgtat tatatgaatc agcacataga      1020
     cctctatata atgatgatta tatgagaata ctaaatgatt attattatgc aatcgaactg      1080
     tttgctattt tcgtgaatac aataatctca gatattgaaa atctgggata tatttctgat      1140
     caagagtttg cacagcaggt tcagtattat gaagatggtg ttgagttatt ttataaaggt      1200
     gtcgaagatt ttgaattcca tcttattaat ttgggtgaaa ttgatgagta tggtgttatt      1260
     ctggattatt atgatgacgg agatactatt tag                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page