(data stored in ACNUC7421 zone)

EMBL: CP001791.PE196

CP001791.PE196       Location/Qualifiers
FT   CDS_pept        213054..214289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0201"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: shn:Shewana3_4163 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97748"
FT                   /db_xref="GOA:D6XVX5"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX5"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADH97748.1"
FT                   /translation="MTNKLVPEIRFDSFKDKWLTRNLNEIMKFSNGINAPKEAYGQGRK
FT                   MISVLDILSEEYLTYDNVRNSVSVSEILEQKNKVEFGDLVFVRSSEVLNEVGLSKAYLD
FT                   NEYALYSGFSIRGKKISEYDPIFVERSLNGISRRQIERKSGGSTRYNVSQEILNSLFIN
FT                   MPTVQEQQKIGEFFKNLDDRIALQQQHITLLKESKQGFLQKMFPKDGERVPEVRFDGFS
FT                   GEWEVLEIKNIAAETYGGGTPKTSISDYWNGNIPWIQSSDLKTDVLNLVSPTKFISDAG
FT                   INNSATKLVPENSIAIVTRVGVGKLALVPYPYATSQDFLSLSSLKIDLKFALYSLYLII
FT                   KKEVNNLQGTSIKGITKPELLKKKIIIPSNLKEQQKIGEFFKNLDDSIAAHEKELELLQ
FT                   ETKKGFLQKMFV"
     atgacaaata agctggtacc tgagattcgg tttgatagtt ttaaagataa atggttaaca        60
     agaaatttga atgaaataat gaaattttca aatggcatta acgctccgaa agaagcatac       120
     ggtcaaggta gaaaaatgat tagtgtactc gatattttat ctgaagagta cctaacttac       180
     gataatgtta ggaattcagt tagtgtttct gaaattttag aacaaaagaa taaagtagaa       240
     ttcggagatt tagtttttgt aagatcatca gaagtattaa atgaagttgg cttgtcaaag       300
     gcatatttgg ataatgaata tgccttatat agcgggttct caattagagg aaaaaaaatt       360
     tctgaatatg atcctatatt tgttgaaaga tctttgaatg gaattagcag aagacaaatt       420
     gaacgtaaat caggtgggag tacaagatat aatgttagcc aggaaattct aaactctctt       480
     tttattaaca tgcctaccgt acaagaacaa caaaaaatcg gcgaattctt caagaacctc       540
     gacgaccgca tagcccttca gcaacaacac atcacattat taaaagaaag caaacaaggc       600
     tttttgcaga agatgtttcc gaaggatggc gaacgtgtgc cggaggttcg gtttgatggg       660
     tttagtgggg agtgggaagt tttagaaata aaaaatattg ccgcagaaac ttatggtgga       720
     ggcactccaa aaacttcaat aagtgattac tggaatggga atattccttg gatacaaagc       780
     agtgatctta aaacagatgt tttgaattta gtttcaccca caaagtttat aagcgatgca       840
     ggtattaata attcagcaac taaacttgta cctgaaaatt caatcgctat tgttactaga       900
     gtaggggtcg ggaaattagc attggttcca tatccttatg ctactagtca agatttttta       960
     tctttatcat cgttaaagat agatttgaaa tttgcattat attcacttta cttaatcatt      1020
     aaaaaagaag ttaataactt acaaggtaca tctattaaag gaataactaa accggagtta      1080
     ttaaagaaaa aaataataat accttcaaat ttaaaagaac aacaaaaaat cggtgaattc      1140
     ttcaagaatc tcgatgattc tattgccgct cacgaaaaag aactcgaact gttacaggaa      1200
     acgaaaaaag gattcctgca aaaaatgttt gtctag                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page