(data stored in ACNUC7421 zone)

EMBL: CP001791.PE197

CP001791.PE197       Location/Qualifiers
FT   CDS_pept        214302..217466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0202"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="TIGRFAM: type I site-specific deoxyribonuclease,
FT                   HsdR family; PFAM: type III restriction protein res
FT                   subunit; protein of unknown function DUF450; KEGG:
FT                   hsm:HSM_1615 HsdR family type I site-specific
FT                   deoxyribonuclease; SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97749"
FT                   /db_xref="GOA:D6XVX6"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX6"
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /protein_id="ADH97749.1"
FT                   /translation="MQSLSHRSEAEIENHLIQVLGEGHNQWTFRDDLKSEADLWQNLRQ
FT                   KITQNNLSELGDTPLTDKEFDAIKTELLFRTQTPFDAAKWLKGENGIARITIEREDSHQ
FT                   GFVSLVLYSNQDIGGGISSYEVVNQIAKQSATDGGRDRRFDVTLLINGLPIVQIELKKV
FT                   TAKDGVYQAFNQIKKYAEEGMFRNNIFATLQLFVVSNEQTTRYFANAMPRNLHRKFMFS
FT                   WRTKDNKKVENLYEFCKQALNIPDAHRLIANYTIVSEDQDNKTLMVLHPYQIHAIEALF
FT                   TAVNKHQSGYVWHATGSGKTLTSFVSTKLLAKKSGIDRTIMLVDRKDLDSQTTSEFTKF
FT                   ASEFNTGISSGNTPANSLIVGTGSAQELSKTLLADANSNVVIITTRQKLDSALKHAKKQ
FT                   EEQKGSNRYEKLMGQHIVFIVDECHRALSAENMEETKKFFPNSTWFGFTGTPIFEENKK
FT                   QAKGQLARTTFDQYGDKLHSYTIKNALEDGSVLGFQVEHETTIKPISLDEMIYTKLRNS
FT                   EAYTHMPDEAINIEINKMTGMQKEAYIDKETYEKDEHIDTVIKKIFSPNNAYIKFDFKN
FT                   GKPTKSAILTTSSIDMAKRYYKAIKAMTSEENWMEEVFQDRPLRKGQTMDDPDFPRIAI
FT                   TYSLDENNENAIDQQEEMQEIIDDYNRYYKTAWSLQDIERYNGDINNRLARKRAEFQQP
FT                   GRQVDLVIVVDRLLTGFDAPTIQTLFVDRNLEYAGLIQAFSRTNRTYPDKTKGLIVTFR
FT                   KPHKMEDNVAKATKLYSEVKEESGLIYPSYDSAKKRFKKAHKELEAIIEEEGQIDEQAP
FT                   IDTRVDYVKAFQELNNAYEALVTYDSYNNDIDTSKALQAQVNVLKEEMGVYETVKGSLI
FT                   EDEPIIDPINPPDFSDLTFYSDASAKLYDIDSSYIDQLLGTYQANNPDVRDEIEEALKK
FT                   LNKAETVKDVYRSILNAIDDKEVDEAEDIFAVKRRFFTEKKEQIVEGFSNYWHVSSNEL
FT                   HASAIQYMIGMDAIPNMKSIIESKDYDAFKVEHPDVKPFKYPQMMKREWQQVLDEQIVP
FT                   LDDELR"
     gtgcagagcc tgtctcatcg ttcagaagct gaaatcgaga accatctcat tcaagtattg        60
     ggggaagggc ataaccagtg gacgtttcgt gatgatttga agtccgaagc ggacctttgg       120
     caaaaccttc gtcaaaaaat cacccagaat aacctgtctg aactcggtga cacaccactg       180
     acggataagg aatttgatgc gattaaaacg gagcttttgt tccggacaca gacgccgttt       240
     gatgcggcaa agtggttaaa aggcgagaac gggatcgccc ggatcaccat tgaacgggaa       300
     gacagccatc aggggtttgt gtcccttgtg ctgtattcca atcaggatat cggtggcggg       360
     atctcaagct atgaggttgt gaaccagatt gccaaacagt ctgctacaga cggcgggcgg       420
     gatcgccgtt ttgatgtaac gctattgatc aacggtcttc ccatcgtgca aattgaactg       480
     aaaaaggtca ccgccaagga cggcgtgtat caagccttta accagatcaa aaagtacgcg       540
     gaagaaggga tgttccgaaa caatatcttt gccaccctgc agctgttcgt tgtctccaat       600
     gaacagacga cgcggtactt tgccaacgcg atgccgagaa acctgcatcg gaagttcatg       660
     ttcagttggc gcacgaagga taataagaaa gtcgagaacc tctatgaatt ctgtaaacag       720
     gccctgaata ttcccgatgc ccaccggctg attgccaact acaccatcgt cagtgaggat       780
     caggataaca aaaccctgat ggtgcttcat ccgtatcaga tccacgccat cgaagcgctc       840
     tttaccgcag tcaataaaca tcagtcgggc tacgtgtggc atgcgacagg ctccgggaaa       900
     acgctcacga gctttgtgtc gacgaagctg cttgcgaaga agtccggtat tgaccgcacg       960
     atcatgctcg tggaccgtaa agatttggac agtcagacaa cgagtgaatt tacgaagttc      1020
     gcctccgagt tcaatacagg gatctcgtca ggaaacactc cggcaaatag cttaatcgtc      1080
     gggaccggaa gtgctcagga actgagtaag acgctgttgg cggatgcgaa ctcgaacgtc      1140
     gtcatcatta cgacgcgtca aaagctcgat tcggcgttaa aacatgcgaa gaaacaggaa      1200
     gaacaaaagg ggtcaaaccg gtatgaaaag ctgatgggcc agcatatcgt cttcatcgtc      1260
     gacgaatgcc accgggcgtt gagtgcagag aacatggaag agacgaagaa gttcttccct      1320
     aactccacgt ggtttgggtt taccgggaca ccgatctttg aagagaataa gaaacaggcc      1380
     aaaggacaac tggcacgaac gacctttgat cagtatgggg ataagctcca ctcgtatacg      1440
     atcaaaaatg cgttggagga cggctcggtc ctcggctttc aggtggaaca tgaaacgacg      1500
     atcaagccca tctctctaga tgagatgatt tacacgaaac tccgaaacag tgaggcttat      1560
     acgcatatgc cagatgaagc catcaatata gagatcaata agatgacggg catgcaaaaa      1620
     gaggcctata tcgataagga aacgtacgag aaggatgaac atattgatac agtaatcaaa      1680
     aagatcttca gtccgaataa tgcctatatc aagtttgatt tcaagaacgg gaagccgacg      1740
     aaatccgcca tcctgacaac gagctccatc gatatggcca agcgctatta caaagccatt      1800
     aaagcaatga ccagcgagga aaactggatg gaagaggtct ttcaagaccg gccgctccga      1860
     aaaggccaga cgatggacga cccggacttc ccgcggattg cgattacgta ttcattggat      1920
     gaaaacaacg agaacgccat cgatcagcaa gaggagatgc aggagatcat tgacgactat      1980
     aaccgttact acaaaaccgc ctggtccctg caggacattg aacggtataa cggggacatc      2040
     aacaaccgac tggcacgaaa gcgtgcagag ttccaacagc cgggccgtca ggtggatctg      2100
     gtcatcgtag tcgatcgctt attgacgggc tttgatgccc cgacgattca gacgctgttc      2160
     gtggatcgga acctcgaata tgccggactg attcaggcgt tctccagaac gaaccggacg      2220
     tatcccgata agacaaaggg gctcatcgtc acgttccgta aaccgcacaa gatggaagac      2280
     aatgtggcga aggcaacgaa gctgtattca gaagtgaagg aagagtccgg tctcatttat      2340
     ccaagctatg attcggcgaa gaaacgcttc aaaaaggcac ataaagagct ggaggcgatc      2400
     atcgaagaag aagggcagat cgatgaacag gcaccgatcg atacccgtgt ggactatgtg      2460
     aaagctttcc aggagctcaa taacgcctat gaagcactgg tgacctatga cagctacaac      2520
     aatgatatag atacgtccaa agccttgcag gcacaggtga atgtattgaa agaggaaatg      2580
     ggtgtgtatg aaacggtgaa ggggtccctg attgaggatg aaccgatcat agatccgatc      2640
     aatccaccgg atttctctga tttgaccttc tacagtgacg catcagcaaa gctctatgac      2700
     attgactcca gctacatcga tcagctgctt ggtacgtacc aggcaaataa cccggatgtc      2760
     cgcgacgaga tcgaagaagc ccttaagaaa ttgaacaagg ctgaaactgt gaaggacgtc      2820
     taccgttcga tcttaaacgc catcgatgac aaagaagtgg atgaagcaga agatatcttt      2880
     gccgtgaagc gccgcttctt taccgagaag aaagaacaga ttgtcgaagg attcagcaat      2940
     tactggcacg tatccagtaa cgagctacat gcatccgcca ttcaatacat gatcggcatg      3000
     gacgctattc ccaacatgaa gagcatcatt gaaagcaagg actatgacgc cttcaaagtg      3060
     gaacatccgg acgtgaaacc gttcaaatac ccacagatga tgaagcggga gtggcagcag      3120
     gtccttgatg agcagattgt accgctggat gatgagttga ggtaa                      3165
//

If you have problems or comments...

PBIL Back to PBIL home page