(data stored in ACNUC7421 zone)

EMBL: CP001791.PE199

CP001791.PE199       Location/Qualifiers
FT   CDS_pept        219331..220116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97751"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97751.1"
FT                   /translation="MMNGVILMYSDQEKEILVDVENVVSRYFNLSDLVINNLPHQIEND
FT                   DLYTLEEVAEILSMSIVTIRQYVRQGKLKAIKQWKNWMVPSNAIAKMIYERKNGKKLRE
FT                   NETMLVIVAGDLYEEDSSIRDYQIITAGDLLANINANSSVAIDDYIYTVMPNQKEHLIY
FT                   IEATSNINNFFRRTGDIVFSDLSKVEAPLESFLPEEKKALSHIISNRDHLIVENPNEAL
FT                   LTIKELFGEPEDVYTVLKIYKALLEVAGEEFKGQKKGDV"
     atgatgaacg gtgtgatact aatgtatagt gatcaggaaa aagaaatatt agttgatgtt        60
     gaaaacgttg taagtagata ttttaattta tcggacttag ttattaacaa cttgcctcat       120
     caaattgaaa atgacgattt atacacatta gaagaagtgg ccgaaatact ttctatgtca       180
     attgttacga ttcgccaata tgtgagacaa ggaaagttaa aggctattaa acaatggaaa       240
     aattggatgg ttccatcgaa tgctattgca aaaatgattt acgaaagaaa aaacggtaag       300
     aaactgagag aaaatgaaac gatgctggtc atagttgcgg gagatctcta cgaagaagat       360
     agttcgatca gagactatca aataattaca gcaggagatc ttttagcaaa tataaatgca       420
     aattcttcgg ttgccattga tgactacatt tatacggtga tgccaaatca aaaagagcat       480
     ctcatttata ttgaagcgac tagcaatatt aataattttt tcagaaggac aggcgatatt       540
     gtattcagtg atttgagtaa agtggaagca cctcttgaaa gcttcttgcc ggaagaaaaa       600
     aaagcattga gtcatatcat cagcaataga gatcatttaa tagtcgaaaa tccaaatgag       660
     gctttattga cgattaagga attgttcggt gaaccagaag atgtttatac agtattaaag       720
     atatataaag ctttgttgga agtagcagga gaagaattca aaggacaaaa gaaaggagat       780
     gtctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page