(data stored in ACNUC7421 zone)

EMBL: CP001791.PE2

CP001791.PE2         Location/Qualifiers
FT   CDS_pept        2218..3360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: glo:Glov_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97554"
FT                   /db_xref="GOA:D6XUZ6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6XUZ6"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADH97554.1"
FT                   /translation="MKFTIQRDAFVQSVADVSKAISPRTTIQILTGIKIVADQDGITLT
FT                   GSDSDLSIESFIPKEKDGEELVNIQEEGSIVLQARFFGDMIKKLPETSIEVAVNDQFIA
FT                   QITSGGSVFNINGIDPDEYPRLPDVEEADLFRMPKNLLKTLIRQTAFAVSSVETRPILT
FT                   GIHWHLEDSVLTCTATDSHRLAMRMAKVDDNENNLSFSNVVIPGKTLTELNKILNDTDE
FT                   LLEVVVAGNQILFKGDYFLLYSRLLEGNYPATKNMIPTGSKTSVKLETKRLLDAIERAL
FT                   LLSREGKNNVVHVKNLESGELEITSVTPEVGKVTEHVTTMSYEGDELKISFNGKNLIDA
FT                   LRVMEASEVHINFTGAMSPFVLKPIDEDHMLHLFSPVRTY"
     atgaaattta ccatccagcg ggacgcattt gtacaaagtg tagcggacgt atcaaaagcc        60
     atttcaccaa gaacaaccat tcaaattctg acaggcataa aaatcgttgc cgatcaggac       120
     ggcattaccc tgacaggaag tgattctgat ctgtcgattg aatcctttat tccaaaagaa       180
     aaagacggtg aagaactcgt caatatccag gaagaaggat cgattgtcct ccaggcacgc       240
     ttttttgggg atatgatcaa aaaactgccg gaaacgtcga tcgaagtagc tgttaacgat       300
     cagttcattg cacagatcac atcaggcgga tctgttttta atatcaacgg gattgatcct       360
     gatgaatatc cccgccttcc ggatgttgaa gaggccgatc tcttcaggat gcctaaaaat       420
     ttactaaaaa cattaattcg tcaaacggcc tttgccgtct cgtcggttga aacccgacca       480
     atcttgacgg gtatacactg gcatcttgaa gacagtgtcc tcacgtgtac tgcaacagac       540
     agtcaccgtc ttgccatgcg aatggccaag gtcgatgata atgagaataa cctcagcttc       600
     tcgaatgttg tcatcccggg taaaacattg acggagctca acaaaatcct gaatgatacg       660
     gatgaactgc tcgaagtggt tgtagccggc aatcagattt tgtttaaagg cgactatttc       720
     cttttgtatt cacggcttct tgaaggaaat tatccggcga ccaaaaatat gattccaaca       780
     ggcagcaaaa cgtcagtgaa gctcgaaacg aagcgtctcc tcgatgcgat cgagcgcgcg       840
     cttcttcttt cacgggaagg gaagaataac gttgttcatg tcaagaactt ggaaagcggg       900
     gaactcgaaa tcacctcggt caccccggaa gtcggaaaag tgaccgaaca tgtgacgaca       960
     atgagctatg aaggcgatga actgaaaatt tcgttcaacg gaaaaaatct gatcgatgcc      1020
     ctgcgtgtga tggaggccag tgaagtccac atcaacttta ccggtgcgat gagccctttt      1080
     gtattaaaac cgattgacga agaccatatg cttcacctct tcagcccggt gcggacatac      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page