(data stored in ACNUC7421 zone)

EMBL: CP001791.PE201

CP001791.PE201       Location/Qualifiers
FT   CDS_pept        220905..221189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0206"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bph:Bphy_3633 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97753"
FT                   /db_xref="GOA:D6XU44"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6XU44"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADH97753.1"
FT                   /translation="MTTRKRRSFTKEFKEQIVQLHQAGKPRSELIKEYELTPSAFDKWV
FT                   RQYQGSGSFKEKDNRTSVEEELLQLKKENKQLTMENDILKQAALIIGRK"
     atgacaactc gcaaacggag aagtttcaca aaggaattca aagaacagat cgtgcaactg        60
     catcaagctg gcaagccccg atccgaactc atcaaagaat acgagctgac gccttctgcc       120
     tttgataaat gggttaggca ataccagggt agtggatctt tcaaggaaaa ggataaccgt       180
     acgtctgttg aagaagagct gttacagctc aagaaagaaa ataaacagct gaccatggaa       240
     aatgatattt taaagcaagc cgcgctgatc ataggacgaa agtaa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page