(data stored in ACNUC7421 zone)

EMBL: CP001791.PE202

CP001791.PE202       Location/Qualifiers
FT   CDS_pept        221231..222019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0207"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   net:Neut_2192 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97754"
FT                   /db_xref="GOA:D6XU45"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D6XU45"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADH97754.1"
FT                   /translation="MCDVLQIARSSFYYESKRQNESEQEELTELIVSIFMKSRKIYGQR
FT                   KIKAELKRAGWTVSRRRIKRIMAEQGLVSKYTVAQFKPSKSSCNESETGNTLDRKFDQD
FT                   DELSVVVSDLTYVRVNKAWHYICVLVDLYNREIIGFSAGPHKTAELVQTAFASVPYNLN
FT                   RIEIFHTDRGTEFKNHLIDQALDTFGITRSLSDKGTPYDNAVAEATFKTIKIEFVRGAV
FT                   FSSQQELDLELFDYVNWFNNIRIHGSLDYLSPAEYKSTGP"
     atgtgcgacg tcctacaaat tgcaagaagc tcattctatt acgaatccaa acggcaaaat        60
     gaatcagagc aagaagaact gacagaattg atcgtaagca ttttcatgaa gagtcgtaag       120
     atctatggtc aacggaagat caaagctgaa ttgaaaagag ctggatggac ggtgtcgaga       180
     cgccgtatca agcggatcat ggctgaacag ggtttggtat caaagtatac cgtagctcaa       240
     tttaaacctt caaaatctag ctgcaatgaa tccgaaacag gcaacacact ggaccggaag       300
     tttgatcagg acgacgaatt aagcgttgtt gtcagcgatt taacgtatgt ccgcgtgaac       360
     aaagcatggc attatatttg tgtattagtc gatttatata atcgtgagat tattgggttc       420
     agcgccgggc ctcataaaac cgctgaatta gttcaaactg cctttgcatc cgtcccctac       480
     aatctaaatc ggatcgagat ctttcataca gacagaggca ctgagtttaa aaatcacctg       540
     atcgaccagg cactcgatac cttcggtatt accagatcat tgagtgacaa aggaacgccc       600
     tatgacaatg ccgtagctga agccacattc aagaccatca agatcgaatt cgttcgtggt       660
     gcggtttttt ctagccaaca agaacttgat cttgaacttt ttgattatgt gaactggttc       720
     aacaatattc gaattcacgg atcattggat tatttatcac cagctgaata caagtcaacg       780
     ggaccttaa                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page