(data stored in ACNUC7421 zone)

EMBL: CP001791.PE205

CP001791.PE205       Location/Qualifiers
FT   CDS_pept        226994..228664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0211"
FT                   /product="labile enterotoxin output A"
FT                   /note="KEGG: ppg:PputGB1_4758 labile enterotoxin output A"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97757"
FT                   /db_xref="GOA:D6XVY4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040576"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY4"
FT                   /inference="similar to AA sequence:KEGG:PputGB1_4758"
FT                   /protein_id="ADH97757.1"
FT                   /translation="METIDYFKQRQSKTIEVLKRLMGFLEDGERFGITLDQSVINKIQS
FT                   AINTVETDILKVALIGGFSEGKTSIAAAWSEKYDTSSMIISQSESTDNVNIYKLDDFEL
FT                   IDTPGLFGFKETEDRQRFNDLTKKYVSEANLIIYVMNPNNPIKESHKEDLTWLFKDLNL
FT                   LPRTVFVISRFDEEADLEDEDDFNERFYTKRENILSRLNDFGIIQKNEEISVVAVSANP
FT                   FGEGIDHWLSNLNEYKKISRISQLQEATTEKIKSVGGEHSFVVETQMSILRDVIKREMP
FT                   TAMERVVQASKEVEKLRNTFIDIQKELNKSEKKISDARIDLRTNISSHFKDLILQVKGT
FT                   DLNTIDDFFERNIGDEGIVLETDIQNEFDRQLGKITHEISQAEKSLKSSVGHYNNIVGD
FT                   MALDGMKLGGEFLKKGGFQLNKEAVLATRDLLAPSIKFKPWGAFKLAKNLNKGAAVFGA
FT                   VLGLGLEVWESWSKRKKEQEFQKLIEKTVQHLSDQRKEYLAFVNNDEFEHTFFPQYIQL
FT                   LNDIEQIKTEVSNRETIQKEFEKWQHQGEIIEAEYKLLP"
     atggaaacaa ttgattattt caagcaacga caatccaaaa caattgaagt gctgaagaga        60
     cttatgggct ttttggagga tggagagagg tttgggatta cccttgatca aagtgttatc       120
     aataaaatac aatccgcgat caatacagta gaaactgata tattgaaagt tgcattgata       180
     gggggattct cggaagggaa gacatcgatt gccgcagcat ggtctgaaaa atacgatact       240
     tcttcaatga taatcagtca atcagagtca acggataatg tgaatatata caaattagat       300
     gattttgaac tgatcgacac acctggttta tttggtttca aagagactga agatcgacag       360
     agatttaatg atcttacaaa gaaatatgta agtgaagcaa atttaatcat atatgtaatg       420
     aatccaaaca atccgatcaa ggaaagccat aaagaagatt tgacttggct atttaaagac       480
     ctgaatcttc ttcctcgaac tgtttttgtg atcagtcgat ttgatgaaga agcagatttg       540
     gaagatgaag atgattttaa tgaaagattc tatactaaac gtgaaaatat cctatcgcga       600
     ttgaatgatt ttggaatcat tcaaaagaac gaagagatat cagttgtggc tgtttctgct       660
     aatccttttg gagaggggat tgaccattgg ttatcaaatc ttaatgaata caaaaagata       720
     tcacgcataa gtcagttaca agaggcgaca acagaaaaga taaagtcggt tggtggagaa       780
     cattcatttg tcgttgaaac gcagatgagt attcttagag atgtcatcaa acgtgaaatg       840
     ccaactgcca tggagagggt tgtccaagcg tcaaaagaag ttgaaaagtt aagaaataca       900
     tttatagaca tacaaaaaga actgaacaag tcagaaaaaa agatcagtga tgcccgtatt       960
     gatctgagaa caaatatttc atcacatttt aaggacttga ttctccaagt gaaaggaact      1020
     gatttaaata cgattgatga tttttttgaa cggaatatag gggatgaagg aatcgtatta      1080
     gagacggata ttcaaaatga atttgatcgt caattaggga aaattacaca tgaaatctcg      1140
     caagcagaga agagtttaaa atccagcgtt ggtcattaca ataatattgt tggagacatg      1200
     gcattagatg gtatgaaact gggtggggaa ttcctgaaaa aaggcggatt tcaattgaat      1260
     aaagaggctg tacttgctac aagggatttg ttagccccat ccattaaatt caaaccttgg      1320
     ggagcattta agttagctaa aaatttgaat aaaggtgctg cagtatttgg tgcagtttta      1380
     ggcctaggat tagaggtttg ggaaagttgg agtaaaagga agaaagaaca agaattccaa      1440
     aaactcatcg aaaaaactgt tcaacactta agtgatcagc gtaaagaata ccttgctttt      1500
     gttaataatg acgagtttga acatacattt ttcccacagt acatccagtt gcttaatgat      1560
     attgaacaaa taaaaacaga agtaagtaat agagaaacga tccaaaaaga atttgaaaaa      1620
     tggcaacatc aaggagaaat catagaagct gaatataaat tacttccata a               1671
//

If you have problems or comments...

PBIL Back to PBIL home page