(data stored in ACNUC7421 zone)

EMBL: CP001791.PE207

CP001791.PE207       Location/Qualifiers
FT   CDS_pept        230222..230680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97759"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADH97759.1"
FT                   /translation="MKDFFNSAKGKWDQVKASTYRLKLDGDKLMRLAINTVPADKNIVI
FT                   ESIDVVSGTIVVTGKTMKYKINHNFSLTVVPDGFNDREISFKLITMKPFNNEWLKSQVF
FT                   TDVSPYVHYDNSRFTLELNKIANVEKSPFGKIKESTIAEDKYVIGFGV"
     atgaaagact ttttcaattc ggctaagggc aagtgggatc aagtaaaagc atctacttac        60
     agattaaaac ttgatggaga taaacttatg agacttgcga taaatacagt gccagcggat       120
     aaaaatatcg tcatcgagag tattgacgta gtttccggta cgattgtggt aacaggtaaa       180
     acgatgaagt ataaaataaa tcataatttt tcattaacgg tcgtacccga tggtttcaac       240
     gaccgggaga tttcattcaa attgattacc atgaagcctt tcaacaatga atggttaaaa       300
     agtcaagtgt tcacagacgt atctccttat gttcactatg ataacagccg tttcacattg       360
     gaactgaata aaattgctaa tgtggagaag tccccgtttg gaaaaataaa agaatcaacc       420
     atcgcagaag ataaatatgt gattggattt ggtgtttga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page