(data stored in ACNUC7421 zone)

EMBL: CP001791.PE209

CP001791.PE209       Location/Qualifiers
FT   CDS_pept        complement(232388..232945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bsel_0215"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: mxa:MXAN_4309 ECF subfamily RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bsel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH97761"
FT                   /db_xref="GOA:D6XVY8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6XVY8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADH97761.1"
FT                   /translation="MTDEELIQEILDGNDEAMKELHGRHVQSVFQYLYIQMSDYHDAQE
FT                   LLQDVMYKAARRLATFKGDSAFKTWLFAIAKHAVIDYYRTRGKRRRTTAVDNTVMDAVG
FT                   DLKESAEQTVIRQMETESVMQTIRQLPQTYRDVLHLRFIEGFSIKETAKVMGKTSMSVK
FT                   ALQKRARAELVNRIGNEVTAYE"
     atgacagatg aagagctgat tcaggaaatt ctcgacggca atgatgaagc gatgaaggag        60
     ctgcatgggc gtcatgtgca gagtgtgttt cagtatttgt acatacagat gagtgattac       120
     catgacgcgc aggagctgct ccaggatgtg atgtataaag cggctaggag acttgcgaca       180
     ttcaaaggag actcggcttt taaaacctgg ctgtttgcga tcgcaaagca tgccgtcatt       240
     gattactacc ggacgcgtgg taaacggcga cgaactacag cggttgataa cacggtcatg       300
     gacgcagtgg gcgatcttaa ggagtcggct gaacaaaccg taatcagaca gatggagact       360
     gaatcggtca tgcagacgat caggcaactg ccgcaaacgt accgggatgt cctgcattta       420
     cgatttattg aagggttctc aattaaagaa acagcaaaag tgatgggaaa aacgtcaatg       480
     tcggtgaagg cattgcaaaa gcgggcgcga gcggaactgg tcaaccggat tggaaatgag       540
     gtgacggcat atgaataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page